KEGG   Tupaia chinensis (Chinese tree shrew): 102490273
Entry
102490273         CDS       T02978                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup01100  Metabolic pathways
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04727  GABAergic synapse
tup04742  Taste transduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05032  Morphine addiction
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102490273 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102490273 (ADCY4)
   04371 Apelin signaling pathway
    102490273 (ADCY4)
   04020 Calcium signaling pathway
    102490273 (ADCY4)
   04072 Phospholipase D signaling pathway
    102490273 (ADCY4)
   04024 cAMP signaling pathway
    102490273 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102490273 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102490273 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102490273 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102490273 (ADCY4)
   04062 Chemokine signaling pathway
    102490273 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102490273 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102490273 (ADCY4)
   04912 GnRH signaling pathway
    102490273 (ADCY4)
   04913 Ovarian steroidogenesis
    102490273 (ADCY4)
   04915 Estrogen signaling pathway
    102490273 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102490273 (ADCY4)
   04921 Oxytocin signaling pathway
    102490273 (ADCY4)
   04926 Relaxin signaling pathway
    102490273 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102490273 (ADCY4)
   04918 Thyroid hormone synthesis
    102490273 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102490273 (ADCY4)
   04916 Melanogenesis
    102490273 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102490273 (ADCY4)
   04927 Cortisol synthesis and secretion
    102490273 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102490273 (ADCY4)
   04270 Vascular smooth muscle contraction
    102490273 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102490273 (ADCY4)
   04971 Gastric acid secretion
    102490273 (ADCY4)
   04972 Pancreatic secretion
    102490273 (ADCY4)
   04976 Bile secretion
    102490273 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102490273 (ADCY4)
   04727 GABAergic synapse
    102490273 (ADCY4)
   04725 Cholinergic synapse
    102490273 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102490273 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102490273 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102490273 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102490273 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102490273 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102490273 (ADCY4)
   04714 Thermogenesis
    102490273 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102490273 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102490273 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102490273 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102490273 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102490273 (ADCY4)
   05163 Human cytomegalovirus infection
    102490273 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102490273 (ADCY4)
Enzymes [BR:tup01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102490273 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102490273
NCBI-ProteinID: XP_006144671
Position
Un
AA seq 1118 aa
MAPQSSTRTCSHPRAAVRTGLDPWDAAAAAVGKRERLRSETFAGQLPSLGLRERSQGLRP
LAAIWEWAERPQGVLEGDRIAARRGAPGRKGEQQELTSDSGFLATVVCALGGFSLLLVLA
SREQRLQRWTRPLSGLVWAALLALGHGFLFTGGVVSAWDQVSFFLFIIFTVYAMLPLGMR
EATAAGLASSLSHLLALGLYLGPQPDSRPALLPQLAANAVLFLCGNVAGAYHKALMERAL
RATFREALSSLHSRRRLDTEKRHQEHLLLSILPAYLAQEMKAEIMARLQAGQGSRPESTN
NFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKI
LGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVI
GLQKWQYDVWSHDVTLANHMEAGGVPGRVHITRATLALLAGAYAVEDTAMEHRDPYLREL
GEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTRYLESWGAAKPFAHLSHVDS
PVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKD
FNPVTLYFRKKEMEKEYRLSALPAFKYYAACTFLVFLSNFIVQMLVTNRPPALAITYCVT
FLLFLLLLFVCFSEHLTRCVLKGPKILHWLPTLSSLVATRPGLRVALGTATILLVFAMAI
TSLFFLPASSDCPFWAPNVSSMAFNLSWELPGSLPLISVPYSMHCCVLAFLSCSLFLHMS
FELKLLLLLLWLVTSCSLFLHSHAWLSDCLVARLYLGPLDSRPGVLKEPKLMGAVSFFIF
FFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNR
RNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFS
GVEKIKTIGSTYMAATGLNATSGQEAQQDTERSCSHLGTMVEFAVALGSKLDVINKHSFN
NFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALQSL
GYTCYSRGVIKVKGKGQLCTYFLNTDLTRAGPPSAALG
NT seq 3357 nt   +upstreamnt  +downstreamnt
atggccccacagagctccacgcggacatgctcccacccacgagctgccgtccgcacgggc
ttggacccttgggacgctgccgcagcggctgtcggcaagagggagaggctgcgaagtgag
acctttgctgggcagctccccagtctaggtttgagggagaggagccaaggactgaggccc
ctggccgccatctgggagtgggctgagaggccgcagggagtccttgaaggagaccggatt
gcagcgcgtcggggggcgccgggcaggaagggcgagcagcaggagctgacctcagactcg
ggcttcctggccaccgtcgtgtgtgcactgggcggcttctcactgctattggtcctcgct
tcccgcgagcagcgactgcagcgctggacacggccactctcgggactcgtgtgggccgcg
ctgctcgcattaggccatggctttctgttcaccgggggtgttgtcagcgcctgggaccag
gtgtcttttttcctcttcatcatcttcactgtgtatgccatgttgcccttgggcatgcgg
gaagccaccgctgcaggcctcgcctcctccctgtcgcacctgctggccctcgggctgtac
cttgggccgcagccagactcaaggccagcgctgctgccacagctcgcagcaaacgcggtg
ttgttcctgtgcgggaacgtggcgggagcataccacaaggcgttaatggagcgagcgctg
cgggccacgttcagggaggcactcagctctctgcactcgcgaaggcggctggacactgag
aagaggcaccaggaacaccttctcttgtccatccttcctgcctacctggcccaagagatg
aaggcagagatcatggctcggctgcaggctggacaagggtcccggccagagagcaccaac
aacttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacatc
gtgggcttcacccggctggccagcgagtgctcccctaaggagctggtgctcatgctcaat
gagctttttggcaagttcgaccagatcgccaaggagcacgaatgcatgcggatcaagatc
ctgggggactgttactactgtgtctctgggctgcccctgtcactaccagaccacgccatt
aactgtgtacgcatggggctggacatgtgccgagccatcaggaaactgcgggcagccact
ggtgtggacatcaacatgcgtgtgggggtgcactcaggcagcgtgctctgcggagtcatc
gggctgcagaagtggcagtacgatgtgtggtcccacgacgtcacactggccaaccacatg
gaggcgggtggcgtgccagggcgagtgcacatcacaagggctaccctggccctcctagca
ggggcgtatgctgtggaggataccgccatggaacaccgggacccctaccttcgggagcta
ggggaacctacctatctggtcatcgatccccgggctgaggaggaggatgagaagggcacc
gcagggggattgctgtcctctcttgagggccccaagatgcgtccatcactgctgatgacc
cgctacctggagtcctggggtgcagccaagccttttgcccacctgagccacgtagacagc
cctgtgtccacctctacccctcttccggagaaggccctggcttccttcagtccccagtgg
agcctggaccggagccgaactcccaggggactggatgatgagctggacactggggatgcc
aagttcttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtccaaggat
ttcaacccagtgacactgtacttccgaaagaaggagatggagaaagagtatcgactttcg
gcacttcctgccttcaaatactatgcagcctgcactttcctggtttttctctccaacttc
attgtccagatgctggtgacaaacaggcccccagctctggccatcacctattgcgtcacc
ttcctcttgttcctcctcctgctcttcgtgtgcttctcagagcacctgacgaggtgtgtc
ctgaaaggccccaagatactacactggcttcccacactgtccagcctggtggccacaagg
cccggactgcgagtggccctgggtactgctaccatcctcctcgtctttgccatggccatt
accagcttgttcttcttaccagcatcatcggactgccctttctgggctcccaatgtgtcc
tccatggctttcaacctgtcctgggagctccctgggtccctgcctctcatcagtgtccca
tactccatgcactgctgcgtgctggccttcctctcctgctccctctttctgcacatgagc
ttcgaactgaagctgctgctgctcctgctatggctggtgacgtcctgttccctcttcctg
cactcccatgcctggctgtctgactgcctcgtcgcccgcctctatctggggcccctagac
tccaggccaggagtactgaaggagccaaaactgatgggagctgtctccttcttcatcttc
ttcttcaccctccttgtcctagctcggcagaatgagtattattgccgcttggacttcctg
tggaaaaagaagctgaggcaagagcgggaggagacagagacgatggagaacctgacccgg
ctactcttggagaatgtgctccctgcccacgtggccccccagttcattggccagaaccgg
cgcaatgaggacctctaccatcagtcctacgagtgtgtttgtgtcctgtttgcctcagtc
ccggacttcaaagagttttactctgaatccaacatcaaccatgaggggctagagtgtctg
cggctgcttaatgagatcattgctgactttgatgagctgctctccaagcccaagttcagt
ggagtggagaagatcaaaaccattggcagcacctacatggcagccacaggcttaaatgcc
acctctggacaggaggcacaacaggatactgagcgaagctgcagccaccttggcaccatg
gtggaatttgcggtggccctggggtctaagctggatgtcatcaacaagcactcgttcaac
aacttccgtctgcgtgtggggttgaatcacggaccagttgtggccggagtgattggggct
caaaagccacaatacgacatttggggcaacacggtgaatgtggccagccgcatggagagt
acaggagtccttggcaagatccaagtgacggaagagacagctcgggccctgcagtccttg
ggctacacctgctacagccggggtgtcatcaaggtcaaaggcaaaggccagctctgcacc
tactttctaaacacagacttgacacgagctggacctccttcagctgccctcggctga

DBGET integrated database retrieval system