KEGG   Tupaia chinensis (Chinese tree shrew): 102492697
Entry
102492697         CDS       T02978                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102492697 (RDH5)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102492697 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 102492697
NCBI-ProteinID: XP_006165624
UniProt: L8Y716
Position
Un
AA seq 318 aa
MWLPVLLGALLWAVLWLLRDQQRLPASDAFVFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSVQQAAKWVETHVREAGLFGLVNNAGVAGIIGP
TPWQTREDFLRVLNVNTMGPIGVTLALLPLLHQARGRVINISSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVASFGVRVSIVEPGFFRTPVTNLETLENILQACWARLPPAPQAHYGEA
FLTKYLKVQQRIMNLICDPDLTKVSRCVEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTSVLPKPAQAVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctgtgctgctcggtgccctgctctgggcagtgctgtggctgctccgggac
cagcagagactacccgccagcgatgcctttgtcttcatcaccggctgcgactcgggcttc
gggcgccttttggcactgcgactggaccagaggggcttccgggtcttggccagctgcctg
accccctcaggggcagaagacctacaacgagtggcctcctcccgcctccacaccaccctg
ctggatgtcactgatcctcagagtgtccagcaggcagcaaagtgggtggaaacacatgtg
agggaagcagggcttttcggtctggtgaataatgctggtgtggctggcatcattggaccc
acaccatggcagacacgggaggacttccttcgggtgctgaatgtgaacacaatgggtccc
atcggggtcactcttgccctgctgcccctgctgcaccaggcccggggccgggtgatcaac
attagcagtgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaagttt
ggcctggaggctttctctgacagcctgaggcgagacgtggcttcttttggggtacgagtc
tccatcgtggagcctggcttcttccgaacccctgtgaccaacctggagactttggagaac
atcttgcaagcctgctgggcacggctccctcctgccccacaggcccactatggagaggcc
ttccttaccaagtacctaaaagtgcagcagcgcatcatgaacctcatctgtgacccggac
ctgaccaaggtgagcaggtgcgtggagcatgccctgacagctcgccacccccgaacccgc
tacagcccaggctgggatgccaagctgctctggctgcctgcttcctacctgccagcaagc
ctggtggatgctgtgctcacctcggtccttcccaagcctgcgcaggcagtctactga

DBGET integrated database retrieval system