KEGG   Tupaia chinensis (Chinese tree shrew): 102493027Help
Entry
102493027         CDS       T02978                                 

Gene name
DPP3
Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102493027 (DPP3)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     102493027 (DPP3)
Peptidases and inhibitors [BR:tup01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   102493027 (DPP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 102493027
NCBI-ProteinID: XP_006171389
Position
Un
AA seq 756 aa AA seqDB search
MGEPEAGSEFANRAAAAGPMADTQYILPNDIGVSSLDCREAFRLLSSTERLYAHHLSRAA
WYGGLAVLLQTSPEAPYIYALLSRLFRAEDPDQLRQHALAEGLTEEEYQAFLVYAAGVYS
NMGNYKSFGDTKFVPNLPKEKLERVILGSKAAQQHPEVVRDLWQTCGELMFSLEPGLRHL
GLGKEGITTYFSGDCTMEDAKLAQDFLDSQNLSAYNTRLFKEVNQEGKSCYEVRLASVMG
TEPTLDSEVTSKLKSYEFRGSHFQVTRGDYSPILQKVVEHLEKAKAYAANSHQEQMLAQY
MESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKAMSA
KFERLVASAEQLLKELPWPPAFEKDKFLTPDFTSLDVLTFAGSGLPAGINIPNYDDLRQT
EGFKNVSLGNVLAVAYATQREKLTFLEEEDKDLYIRWKGPSFDVQVGLHELLGHGSGKLF
VQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCFN
PQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPEASNWRQAHMQARFVILRVLLE
AGEGLVTVTPTTGSDGRPDARVRLDRNKIRSVGRPALERFLRRLQVLKSTGDVAGGRALY
EGYAAVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSEVQLLEYEASAAGLIRSFS
ERFAEDGPELEEILTQLATADARFWKGPSKTPPGQA
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgggggagccggaagcaggaagtgagtttgcgaacagagcggctgctgcagggcccatg
gcggacacccagtacatcttacccaatgacatcggcgtgtctagcttagactgccgcgag
gccttccgcctgctgtcatccactgagcgtctctatgcccaccacctgtctcgagccgcc
tggtatggaggcctagctgtgctgctgcagacctcccctgaggccccctacatctacgct
ctactcagccgcctctttcgtgccgaggaccccgaccagctacgccagcatgccctggct
gagggccttacagaggaggagtatcaggcgttcctggtctatgctgcaggtgtctactcc
aacatgggcaactacaaatcttttggtgataccaagtttgttcccaacctgcccaaggag
aagctggaacgtgtaattctggggagtaaggccgctcagcagcacccagaagtcgtcagg
gacctctggcagacctgtggggaacttatgttctctctggagccggggctccgacacctt
ggactggggaaggagggtatcaccacctatttctctggggattgtaccatggaagatgcc
aaactggcccaagactttctggactcacagaacctcagtgcctataacacacggctcttc
aaggaggtcaaccaggaagggaagtcctgctatgaggtgcgactggcttctgtcatgggc
acagagcctactctggattctgaagttacctctaagttgaagagctacgaattccggggt
agtcatttccaagtgacccggggtgactactcccccatcctccagaaggtggtggagcac
ctggagaaagctaaggcatatgcagccaacagtcaccaggagcagatgctggcccagtac
atggaaagcttcacccagggctccatcgaggcccacaaaaggggctcacgcttctggatc
caggacaaaggccccattgtagagagttacatcgggttcatcgagagctaccgggacccc
tttggctcccgaggagagtttgaaggctttgtggccatggtgaacaaggccatgagtgcc
aagtttgagcggctggtggcaagtgcggaacagctgctgaaggagctgccctggccccct
gccttcgagaaggacaagtttctcacacctgacttcacctccctggatgttctcaccttc
gctggctccggccttcctgctggcatcaacatccccaactacgatgacctgaggcagaca
gaaggctttaagaatgtgtcgctggggaatgtgctggctgtagcctatgccacgcagcgg
gagaagctcactttcctggaggaggaggacaaggacctgtacatccgctggaaggggcct
tcctttgatgtgcaggtaggcctgcatgaactgctgggccacggcagcggcaagctcttc
gtgcaggatgaaaaaggagcattcaactttgaccaggagacagtgattaacccagagaca
ggggagcagattcagagctggtaccggagtggggagacctgggacagcaagttcagcacc
attgcctccagttatgaagagtgtcgagccgaaagcgtgggcctctacctctgcttcaac
ccccaagtgctggagatctttggctttgagggggcggatgcggaagatgtgatctatgtg
aattggctcaacatggttcgggctggactgctcgctctggagttctacacccccgaggct
tccaactggcgccaggctcacatgcaggcccggtttgtgatcctgagggtcttgctggag
gctggtgagggacttgtcaccgtcactcctaccacaggctctgatgggcgccctgatgct
cgggtccgccttgaccgcaacaagatccggtctgtgggcagacccgccctggaacggttc
ttgcggagactccaggtgctgaagtccacgggggatgtggctggagggcgggccctgtat
gaggggtatgcggcagttactgatgcacctcccgagtgcttcctcaccctcagggacaca
gtgctgctgcgcaaggaatctcggaagctcatcgttcagcctaacactcgccttgaaggc
tcagaagtgcagcttcttgagtacgaggcctcagctgctggcctcatccgatccttctct
gagcgcttcgcagaagatgggcctgaattggaggagattcttacccagctggccacagct
gatgcccgattctggaagggccccagcaaaaccccacctggccaggcttga

DBGET integrated database retrieval system