KEGG   Tupaia chinensis (Chinese tree shrew): 102493772Help
Entry
102493772         CDS       T02978                                 

Gene name
APEX2
Definition
(RefSeq) apurinic/apyrimidinic endodeoxyribonuclease 2
  KO
K10772  AP endonuclease 2 [EC:4.2.99.18]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:tup00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    102493772 (APEX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tup03400]
    102493772 (APEX2)
Enzymes [BR:tup01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     102493772 (APEX2)
DNA repair and recombination proteins [BR:tup03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     102493772 (APEX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos zf-GRF Exo_endo_phos_2
Motif
Other DBs
NCBI-GeneID: 102493772
NCBI-ProteinID: XP_006163542
UniProt: L8YDM5
Position
Un
AA seq 517 aa AA seqDB search
MLRVVSWNINGIRSPLQGMVYQEPSNCAPMAMGRILNELDADIVCLQETKVTRDVLTEPL
AIVEGYNSYFSFSRNRSGYSGVATFCKDSATPMAAEEGLSGLLATQNGDVGCYGNMDAFT
QEELRALDSEGRALLTQHKIRTWEGKEKILTLVNVYCPHADPGKPERLAFKMRFYHLLQI
RAEALLAAGSHVIILGDLNTAHRPIDHWNAATLECFEEDPGRKWMDRLLSNLSCQADSHI
GSFVDTYRCFQPEQEGAFTCWSVVSGARHLNYGSRIDYVLGDRTLVRDTFQASFLLPEVM
GSDHCPVGAVLNVSCVPAKQCPSLCTRFLPEFAGTQLKIFPFLVHLKQSPMLEKSTVQPS
NQTRVQTRPNKACIRSTRPRPSQVGSSRGQKNLTSYFRHSSSCPQVSPDLELPSLPLMGA
LITPKTSEETVAKVVEEQARVSGAKDEKEIRTLFWKSVLSGPLPTPLCGGHREPCVMRTV
KKPGPNLGRRFYVCARPQGPPSDPLSRCNFFLWDRPS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgtggtgagctggaatatcaatgggatccgaagccccttgcaagggatggta
taccaggaacccagcaactgtgcccccatggccatggggcgcattttgaacgaactggat
gccgatatcgtctgtctacaggagaccaaagtgacccgggatgtgctgacagagcctctg
gctattgttgagggctataactcctatttcagttttagccgcaaccgtagtggttattca
ggtgtagccaccttctgtaaggacagtgctaccccaatggctgctgaagaaggcttgagt
ggattgcttgccactcagaatggggatgtaggttgctatggaaacatggatgccttcacc
caagaggagctccgtgctttggatagtgagggccgtgccctcctcacacaacacaagatc
cgcacatgggaaggtaaagagaagatcttgactttagttaatgtgtattgcccccacgcg
gaccctgggaagcctgagcggctggcctttaaaatgcgcttctatcatttgctgcagatc
cgagcagaagcccttctggctgctggcagtcatgtgatcatcctgggtgacctcaataca
gcccaccgccccattgaccactggaacgcagccactttggaatgctttgaagaggaccca
ggacgcaagtggatggaccgtttgctcagtaacctgtcatgccaggctgattctcacata
ggatccttcgttgatacctaccgctgcttccaaccagagcaggagggggccttcacctgc
tggtcagtagtcagtggcgcccgccatctcaactacggctcccggattgactatgtcctg
ggggacaggaccctggtcagagacaccttccaggcatctttcttgctgcctgaggtgatg
ggctctgatcattgcccagtgggcgcagtcttgaatgtgtcttgtgtgcctgcaaaacag
tgcccatctttgtgtacccgctttctccctgagtttgcaggtacacagctcaagatcttt
cccttcttagttcatctcaaacaatctcctatgttagagaagtcaacagtgcagcccagc
aatcaaacccgggtacagacacgccccaataaagcctgtatacgttcaaccaggcctcgg
ccaagtcaggttggctccagcagaggtcagaaaaacctgacaagctacttccgtcattcc
tccagctgtccccaagtgtctcctgacttggaactacctagtctgccactgatgggtgcc
ctcataaccccaaagacttcagaagagacagtagctaaagtggtagaggaacaggccagg
gtttcaggggccaaagatgaaaaagagatacggaccttgttctggaagtctgtgctgagt
gggcccttgcccacacccctctgtggaggccacagagagccatgtgtaatgcggactgtg
aaaaagccagggcccaacctaggtcgccgcttctatgtgtgtgccaggccccaaggtcct
cccagtgatcctttgtctcgctgcaacttcttcctgtgggataggcccagctaa

DBGET integrated database retrieval system