KEGG   Tupaia chinensis (Chinese tree shrew): 102494219Help
Entry
102494219         CDS       T02978                                 

Gene name
TNFRSF13C
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04060  Cytokine-cytokine receptor interaction
tup04064  NF-kappa B signaling pathway
tup04672  Intestinal immune network for IgA production
tup05166  Human T-cell leukemia virus 1 infection
tup05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102494219 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102494219 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102494219 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102494219 (TNFRSF13C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102494219 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:tup04050]
    102494219 (TNFRSF13C)
   04090 CD molecules [BR:tup04090]
    102494219 (TNFRSF13C)
Cytokine receptors [BR:tup04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102494219 (TNFRSF13C)
CD molecules [BR:tup04090]
 Proteins
  102494219 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind
Motif
Other DBs
NCBI-GeneID: 102494219
NCBI-ProteinID: XP_014444169
Position
Un
AA seq 214 aa AA seqDB search
MRRGSRSRRGREGPAPTPCGRAECFDLLLRHCVACKLLRTPEPRRGPASPPSDPPLPQAS
LPSAPCPPSPSPPIAAGASSLVPRTVLQPQESVGAGAGPEGVLPLHGLLFSAPLLLGLAL
VLALVGLVSWGWQQRRKQRCPGVASPEAPDTDQDESLDNVIVLSPIALDATAPVWPSPAE
DPGTTPPGHNVPVPATELGSTELVTTKTAGPEQQ
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgaggatccaggagccggaggggcagggaggggccggcccccaccccctgcggc
cgcgcagagtgcttcgacctgctgctccgccactgcgtggcctgcaagctgctccgcacg
ccggagcctaggcgcggcccagcctcacctccctctgaccctccccttccccaggcatcc
ctcccctcagccccctgcccaccctctccgtcccctcccatagcagcaggggcgagcagc
ctggtccccaggactgtgttgcagcctcaggagtcagtaggtgcaggggctggccccgag
ggggtgctgcccctgcacgggctgctcttcagcgcccccttgctgctgggcctggcactg
gtcctggccctggtgggcctggtgagctggggatggcaacaacggcggaagcagaggtgt
cctggggtggcctccccggaagccccagacacagaccaggacgagtccctggacaatgtc
atcgtcctctccccgatagcacttgatgccacagctcctgtctggccttcccctgcagaa
gacccgggcaccacaccacccggccacaatgtccctgtgccagccactgagttaggctcc
actgagctggtgaccaccaagacagccggccctgagcagcagtag

DBGET integrated database retrieval system