KEGG   Tupaia chinensis (Chinese tree shrew): 102496040Help
Entry
102496040         CDS       T02978                                 

Gene name
NMNAT3
Definition
(RefSeq) nicotinamide nucleotide adenylyltransferase 3
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00760  Nicotinate and nicotinamide metabolism
tup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102496040 (NMNAT3)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     102496040 (NMNAT3)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     102496040 (NMNAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 102496040
NCBI-ProteinID: XP_006158234
Position
Un
AA seq 252 aa AA seqDB search
MKSRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTGTYQVIEGIISPVNDSYGKKDLAA
SHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHGELLRSLPQTEGPDHDKAL
SPPPAAVPELKLLCGADVLKTFQTPNLWEDAHIQEIVEKFGLVCVGRAGHDPKGYISESP
ILRRYQHNIHLAREPVQNEISATYIRRALSQGQSVKYLLPDAVIAYIKEHNLYSKDGPPT
GKGPQGQEGKAS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaagagccgaattcctgtggtgctcctggcctgtggctccttcaaccctatcaccaac
atgcacctgcgcctgtttgaggtagccagagaccacctacaccagacaggaacgtaccag
gtgatcgagggcatcatctcccctgtcaatgacagctacgggaagaaagacctcgcggct
tcccaccaccgagtggccatggcccggctggctctgcagacttctgactggatccgggtg
gacccctgggagagtgagcaggcgcagtggatggagacggtaaaggtgctgaggcatcac
catggcgagctgctcagatctctgccacagacggaaggcccggaccacgacaaggcgctg
tccccaccccccgcagctgtgcctgagctgaagctcctctgcggagcggacgtcttgaag
accttccagaccccgaacctctgggaagacgcacacatccaggagatagtggagaagttt
ggcttggtgtgcgtgggccgggcgggtcacgaccccaaggggtacatctcggaatccccc
atcctgcggaggtaccagcacaacatccacctggcccgggagcccgtgcagaacgagatc
agcgccacgtacatcaggcgggccttgagccaggggcagagcgtgaagtacctgctccct
gatgcagtcatcgcctacatcaaggagcacaacctctacagcaaggacggccccccgaca
ggcaaaggcccccagggccaggagggcaaggccagctag

DBGET integrated database retrieval system