KEGG   Tupaia chinensis (Chinese tree shrew): 102496549
Entry
102496549         CDS       T02978                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102496549 (ANKRD53)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    102496549 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4 PHD
Other DBs
NCBI-GeneID: 102496549
NCBI-ProteinID: XP_006151334
UniProt: L9KS87
Position
Un
AA seq 499 aa
MASVDWTSLWARVGSRNSEGSERRGAQQRPAQRGSKQRALKIASIVTWSDTESRQPSLPE
ESDHRAIGRSSYELFAASVGNPEWLRFCLNQDPEEIATDDKGFAATHFAAQGAKLACLKV
LIEEYKFPVDLRTSKSQTPLHLVIHRDNKAIAIPCIRYLLEQGAALNAQTCNGSTPLHLA
AREGLLACVKFLVQSGADVHARDAMGCKPIDLCKIWNHRTCARFLKDAMWKRDKKDFACE
MGKLKKLKDQLIVLEQNYLAEYQKQLQLLRKADYRKWLHCKQLLGQRHSLNPPTKQEASA
PPRTIALSMASEYQGLQPSKHFHPFAKVHRQCIPQPNDTVKPIYPQQMVRRPEMWNSSNN
PARPPTTQISYPQGIRMSVHPDPSGEHDFSSFLKVTPDRHGGARLRTVDGHWVAPVPRLP
FEVVVRALYPQVQPYRMKVPQGLYPISMQSMSGKRHLGNDNFWTDALAMSLRETFDEAFL
ETMRAHGGLPALPSPKAPL
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcctccgtggactggacctctctgtgggcgagagtggggagtcgaaactcagaaggg
agcgaacgaagaggagcccagcaacgaccagctcaacgtggctccaagcagcgggcgttg
aaaattgcctcgattgtcacctggagtgacacagagtccaggcagcccagcctccccgag
gagtcggaccacagggccatagggcgctcctcctacgagctgttcgccgcctcagtgggc
aacccggagtggttgagattttgcctgaatcaggaccctgaggaaatcgcgaccgacgac
aaaggcttcgctgccacccactttgccgcccagggggccaagctcgcatgcctgaaggtc
ttgatagaggagtacaagtttcctgtggacctgcgcaccagcaagagccagacccccctg
catctcgtcatccatagggacaacaaggctatagccatcccctgcattcgctacctgctg
gagcagggggcagccctcaatgctcagacgtgcaatggttccacacccctgcacctggca
gcccgcgagggcctgctggcctgtgtgaagttcctggtacagagtggtgcagatgtccat
gcccgagatgccatgggttgcaagcccatcgacctctgcaaaatatggaaccaccgcacc
tgtgcccggtttttgaaggatgccatgtggaaacgggacaagaaggactttgcctgtgaa
atggggaaactgaagaagctcaaggaccaactgatcgtcctggagcagaactacctggct
gagtatcaaaaacaactccaacttctgagaaaagctgattacaggaagtggctccactgc
aagcagctgctaggccagagacactccctgaacccccccaccaagcaagaggccagtgcc
ccaccaaggaccatcgccctctccatggcctcagagtaccaggggttgcagccttcgaag
cacttccacccctttgcgaaggtgcaccggcaatgcataccacagcccaacgacacagtc
aagcccatctacccacagcaaatggttaggcggcccgagatgtggaactctagcaacaac
cctgccagaccccccaccacccagatcagctatccgcagggcatccgcatgagcgtgcat
ccagaccccagcggggagcacgacttcagcagcttcttgaaggtgacgcccgacaggcac
ggcggtgcgcggctgcgcacggtggacggccactgggtggcgcccgtgcctcggctgcct
ttcgaggtggtggtccgtgcgctgtaccctcaggtgcagccctataggatgaaggtgccc
cagggtctttaccccatcagcatgcaaagcatgtccgggaagcgacacctcgggaatgac
aacttctggactgacgctctggccatgagcctgcgtgagacatttgatgaagccttcctg
gaaaccatgagagctcatggagggcttcctgctctcccctctcccaaggcccccctataa

DBGET integrated database retrieval system