KEGG   Tupaia chinensis (Chinese tree shrew): 102497538Help
Entry
102497538         CDS       T02978                                 

Gene name
CACNA1I
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup04020  Calcium signaling pathway
tup04713  Circadian entrainment
tup04925  Aldosterone synthesis and secretion
tup04927  Cortisol synthesis and secretion
tup04929  GnRH secretion
tup04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102497538 (CACNA1I)
   04020 Calcium signaling pathway
    102497538 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    102497538 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    102497538 (CACNA1I)
   04927 Cortisol synthesis and secretion
    102497538 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102497538 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102497538 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102497538 (CACNA1I)
Ion channels [BR:tup04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102497538 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 102497538
NCBI-ProteinID: XP_014444168
Position
Un
AA seq 2145 aa AA seqDB search
MAESASPPSSPAAALATEQGVTEQPGPQSPPPSPPGLEEPLDGADPDVPHPDLAPVAFFC
LRQTTSPRNWCIKMVCNPWFECVSMLVILLTCVTLGMYQPCDDMDCLSDRCKILQVFDDF
IFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVR
VLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFL
EENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVY
DFGAARQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVE
IMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLS
SSTVASYAEPGDCYEELLQYPSXKHRLRPLGLHRALQSRRRAAHPGATAPAKPGVHTEEP
RRYQLCPRHSPLDPTPHTLVQPISAMLASDPASCPRCQHEADRRPSGLGSTDSGQEGSGS
GGLGACEDEADGDRAQSSEDGASSGLGKEDAEERADGASWLCGDLWREARAKLRGIVDSK
YFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYL
RNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFLPGLRRQLVVLMKTMD
NVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQ
EDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQ
SSSNMEEFDKLPEGLDSGADPKLCPIPLTPNGHLDPSFPLGGHLGPTGPAAPTPRLSLQP
DPLLMALSSRKSSVMSLGRLSYDQRSLSSSRSSYYGPWGRSGAWASRRSSCYSLKHKLMT
SLKHKLPSAEHESLLSAERGGGCGARAGEGVRDEGPLRTAPLHASHAHHSHHGSHLSHRH
RHHRRTLSLDTRDSVDLVELVPTVGPHPRAAWRAAGLVPGHEDCNGRMPSIAKDVFTKMD
DRRDRGEDDEEIDYTLCFRVRKMIDVYKPDWCEIREDWSVYLFSPENRFRVLCQTVIAHK
LFDYVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYISWPPPSPSPHLSLACPQQPA
SHRVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRT
LRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVD
TRNITNRSDCVAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQP
VTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEK
KRRKAQRLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETAL
KYCNYLFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPI
NPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVE
LFGKLVCDDENPCEGMSRHATFENFGMAFLTLFFFXYWNGIRKDTLRDCTHDERSCLSSL
QFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAHTLGPSP
GPRPPASSPGAPGRCYSPAQENLWLDSVSLIIKDSLDGELTIIDNLSGSIFHHYSSPAGC
DKCHHDDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGPKDSKGEPDPPEPV
RVGDLGECFFPLPNTAVPSGPENFLHEMETIPFHPVRSWLKSESGQVPPRPFSPEDSSPL
LPMPAEFFHPAVSASQKGQEKGTIAGALPKIALQGSWASLRSPSVNCTLLRQATGSDTSL
EANEETEPHGDWLIQVTQQGKVSQPEMETQTTKEVELGSGSYDIPRGLALCRPQVPVPVI
GGVPFSDSTATQIVLGATCPTSFFRCGQNRIHLESPWLGPAHRGLWKEDTDAGQPGNVDD
IIVPSVDEAQGGEGSCPELSTGSSPAQPEEMTLFFPAGSTGIKRT
NT seq 6438 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagcgcctcgccaccctcctcacctgcagcagccctggccactgagcaggga
gtcacggagcagccggggccccagagcccgcctccctccccgcccggcctggaggagccc
ctagatggggctgatcccgacgtcccgcacccggacctggctcctgttgccttcttctgc
ctgcgacagaccaccagcccccggaactggtgcatcaagatggtgtgtaatccgtggttc
gaatgcgtcagcatgttggtgatcctgctgacctgcgtgacgctgggcatgtaccagccg
tgcgatgacatggactgcctgtccgaccgctgcaagatcctgcaggtcttcgatgacttc
atcttcatcttttttgccatggagatggtgctgaagatggtggccctgggcatttttggc
aagaagtgttacctcggggacacgtggaaccgcctggacttcttcatcgtcatggccggg
atggtcgagtactccctggaccttcagaacatcaacctgtcagccatccgcaccgtgcgt
gtcctgaggcccctcaaggccatcaaccgcgtgcccagtatgcggatcctggtgaacctg
ctcctggacacactgcccatgctgggcaatgtcctcctgctctgcttctttgtcttcttt
atcttcggcatcataggtgtgcagctctgggctggcctgctgcgcaaccgctgcttcctg
gaggagaacttcaccatacaaggggatgtggcgctgcccccctactaccagccggaggag
gacgacgagatgcccttcatctgctcgctgtcgggggacaacggcatcatgggctgccac
gagatccccccgctcaaggagcagggccgcgagtgctgcctgtccaaggacgacgtctac
gacttcggggcggcgcgccaggacctcaacgccagcggcctctgcgtcaactggaaccgc
tattacaacgtgtgccgcaccggcagtgccaacccccacaagggcgccatcaactttgac
aacatcggctacgcctggatcgtcatcttccaggtgatcacgctggagggctgggtggag
atcatgtactacgtgatggacgcgcactccttctacaacttcatctacttcatcctgctc
atcatagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccagttc
tcggagaccaagcagcgggagcaccggctgatgctggagcagcggcagcgctacctgtcg
tccagcacggtggccagctacgccgagcccggcgactgctacgaggagctcttacagtac
ccgtctnncaagcaccggctccgccccctgggcctccaccgggccctgcagagccggcgc
cgggctgcgcacccgggggccactgctcccgccaagcccggggtgcacaccgaggagccc
aggcgctaccagctgtgcccgcgacacagtcccctggaccccacaccccacacgctggtg
cagcccatctccgccatgctggcctccgatcccgccagctgcccgcgctgccagcacgag
gcggaccggcggccctcgggcctgggcagcaccgactccggccaggagggctcgggttcc
ggcggcttgggtgcctgtgaggacgaggccgatggggaccgggcccagagcagtgaggac
ggggcctcctcaggcctggggaaggaggacgcggaggagcgggctgatggagcatcctgg
ctgtgcggggacctgtggcgagaggcccgagccaagctgcggggcatcgtggacagcaag
tacttcaaccgcggcatcatgatggccatcctggtcaacaccgtcagcatgggcatcgag
caccacgagcagcccgaggagctgacaaacatcctggagatctgcaacgtggtcttcacc
agcatgttcgccctggagatgatcctgaagctggccgccttcgggctcttcgactacctg
cgcaacccctacaacatcttcgacagcatcatcgtcatcatcagcatctgggagatcgtg
gggcaggcggacggcggcctgtcggtgctgcgcaccttccggctgctgcgggtgctgaag
ctggtgcgcttcctgcccgggctgcgccgccagctcgtggtgctcatgaagaccatggac
aacgtggccaccttctgcatgctgctcatgctcttcatcttcatcttcagcatcctcggg
atgcacatctttggctgcaaattcagcctccgcacggacacaggagacacggtccccgac
aggaagaacttcgactccctgctgtgggccatcgtcacagtgtttcaaatcctcacccag
gaggattggaacgtcgtcctctacaatggcatggcctctacctccccgtgggcctccctc
tactttgttgctctcatgaccttcggcaactatgtgctcttcaacctgctggtggccatt
ctggtggagggcttccaggcggagggtgacgccaaccgctcctactcggatgaggaccag
agttcatccaacatggaggagttcgacaagctccccgagggcctggacagtggcgcagat
cccaagctctgccccatcccgctgacccccaatgggcacctggaccccagcttcccgctg
ggtgggcatctgggtcccacggggcctgcggcccccacaccccgcctctcgctgcagccg
gaccccttgctgatggccctgagctctcggaaaagcagtgtcatgtcactggggaggctg
agctacgaccaacgctccctgtccagctcccggagctcctactacgggccgtggggccgc
agcggggcctgggccagccgccgctccagctgctacagcctcaagcacaagctgatgacc
agcctcaagcacaagctgccatcggctgagcatgagtccctgctctcggcggagcgaggc
ggtggctgtggcgcccgggccggcgaaggcgtccgggacgaagggccgctgcgcactgcg
cccctgcacgcgtcccacgcccaccactcgcatcatggttcccacctgtcacaccgtcac
cgccaccaccgccggacactgtccctcgataccagggactcggtggacctggtggagctg
gtgcccaccgtgggcccccacccccgggcggcctggagggctgcgggcctggtccccggg
catgaagactgcaatggcaggatgcccagcatcgccaaggatgtcttcaccaagatggac
gaccgccgggatcgcggggaggacgacgaggagatcgactatactttgtgcttccgagtc
cgcaagatgatcgatgtctacaagccggactggtgcgagatccgtgaggactggtctgtc
tacctcttctctccggagaacaggttccgcgtcctgtgtcagactgtcatcgcccacaag
ctctttgactacgtcgtcctggccttcatcttcctcaactgcatcaccatcgccctggaa
cggccccagatcgaggcgggcagcactgaacgcatcttcctcaccgtgtccaattacatc
tcctggcccccgcccagcccctcgccccacttgtcactagcctgccctcagcagcctgcc
agccacagggtggtctcgctgggcctatacttcggtgagcaggcgtatttgcgcagcagc
tggaacgtgctggacggcttcctcgttttcgtgtccatcatcgacatcgtggtgtcggtg
gcctctgctgggggagccaagatcctgggggtcctccgggtcctacggctcctgcgcacc
ctccgccccctgcgcgtcatcagccgggcgcctggcctgaagctggtggtggagaccctc
atctcctctctcaagcccattggcaacattgtcctcatctgctgtgccttcttcatcatc
tttggcatcctgggggtgcagctcttcaagggcaagttctaccactgcctgggcgtggac
acccgcaacatcaccaaccgctccgactgcgtggctgccaactatcgctgggtccaccac
aagtacaacttcgacaacctgggccaggccctgatgtccctctttgtcctggcctccaag
gacggctgggtgaacatcatgtacaacgggctggatgccgtcgctgtggaccagcagccc
gtgaccaaccacaacccctggatgctgctgtacttcatctccttcctgctcatcgtcagc
ttcttcgtcctcaacatgtttgtgggcgtcgtggtggagaacttccacaagtgccggcag
caccaggaggccgaggaggcgcggcggcgtgaggagaagcgtctgcggcgcctggagaag
aagcgccggaaggcccagcggctgccctactatgctacctactgtcccacccggctgctc
atccactccatgtgcaccagccactacctggacatcttcatcacctttatcatctgcctc
aacgtggtcaccatgtccctggagcactacaatcagcccacgtccctagagacagctctt
aagtactgcaactacttgttcaccactgtctttgtgctggaggctgtgctgaaactggtg
gcatttggcctgaggcgcttcttcaaggatcggtggaaccagttggacctggccattgtg
ctgctgtcagtcatgggcatcacgttggaggagatcgagatcaatgcggcgctgcccatc
aaccccaccatcatccgcatcatgcgggtcctgcgcatcgcccgggtgctgaagctgttg
aagatggccacggggatgcgggccctgctggacacggtggtgcaggctttgccccaggtg
ggcaacctgggcttgctcttcatgctgctcttcttcatctacgccgcgctgggagtagag
ctcttcgggaagctggtctgcgatgatgagaacccgtgcgagggcatgagccggcacgcc
accttcgagaacttcggcatggccttcctcacgctcttcttttttntttactggaatggg
atcagaaaggacacgctgcgggactgcacccacgacgagcgcagctgtctgagcagcctg
cagttcgtgtcgccgctgtacttcgtcagcttcgtgctcacggcgcagttcgtgctcatc
aacgtggtggtggccgtgctcatgaagcacctggacgacagcaacaaggaggcgcaggag
gacgccgagatggacgccgagctggagctggagatggcgcacacgctgggccccagccct
ggcccgcgcccgcccgccagctctcccggggccccagggcgctgctactctccagcccag
gagaacctgtggctggacagcgtctctttaatcatcaaggactccttggacggggagctg
accatcatcgacaacctgtccggctccatcttccaccactactcctcccctgccggctgc
gacaagtgtcaccatgacgacaagcaggaggtgcagctggctgagaccgaggccttctcc
ctgaactcagacaggtcctcgtccatcttgctcggagacgacctgagcctcgaggacccc
acggcctgcccacctggccccaaagacagcaagggtgagccagacccgcctgaacccgtg
cgagtcggggacctgggtgaatgcttctttcccttgcccaacacggctgtcccgtcgggc
ccagagaactttctacatgagatggagacgatcccattccaccccgtccggtcctggctg
aagagtgagagcggccaagtgcccccgcgccccttctccccggaagactccagtccgctc
ctgcccatgccagctgagttcttccaccctgcggtgtctgccagccagaaagggcaggag
aagggcaccatcgctggggccctccccaagattgccctgcagggctcctgggcgtccctg
cggtcgccaagtgtcaactgtaccctccttcggcaggccacagggagcgacacgtcgctg
gaggccaatgaggagactgagccccacggagactggctgatccaggtcacacagcagggg
aaagtttctcaacccgaaatggagacacaaaccaccaaggaggtggaattaggctctggc
agctacgatattcctcgagggctcgctctgtgcaggccccaagtccctgtgccagtcata
ggaggagtccctttctctgactccaccgccacccaaatagtgttaggtgctacatgtccc
acgagcttcttcaggtgcggacaaaatcggattcaccttgaatctccctggctgggccca
gcgcaccgaggactgtggaaggaagacaccgatgcagggcagcctggcaacgtggatgac
atcattgtcccttctgtggacgaggctcagggaggtgaggggtcctgtccagagctctcc
actggatccagccctgctcagcctgaagaaatgaccctgttctttccagctggttccacg
ggtattaagagaacatga

DBGET integrated database retrieval system