KEGG   Tupaia chinensis (Chinese tree shrew): 102497644Help
Entry
102497644         CDS       T02978                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102497644 (DOCK7)
Membrane trafficking [BR:tup04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102497644 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 102497644
NCBI-ProteinID: XP_006147584
Position
Un
AA seq 1990 aa AA seqDB search
MDPHVRDCIRSYTEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNS
YQDEQDDLKRRSMSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDRQNDDQRK
SNRHKELFALHPSPDEEDPIERLSVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALY
DVKEKKKISENFYFDLNSEQMKGLLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEK
VLQQGDIGECAEPYMIFKEADATKNKEKLEKLKSQADQFCQRLGKYRMPFAWTAIHLMNI
VSSAGSLERDSTEVEISTGERKGSWSERRNSSIVGRRSLERTTSGDDACNLTSFRPATLT
VTNFFKQEGDRLSDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPYYCLTPEL
LQVKLYPDSRVRPTREILEFPARDVYVPNTTYRNLLYIYPQSLNFANRQGSARNITVKVQ
FMYGEDLSNAMPVIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLF
TFYHVSCQQKQNTPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLP
GMKWVDNHKGVFNVEVVAVSSIHTQDPYLDKFFALVNALDEHMFPVRIGDMRIMENNLEN
ELKSSISALNSSQLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRL
HKNLEGNQDQHGRNNLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPAS
LNLNRSRSLSNSNPDISGTPTSPDDEVRSIIGSKAMDRSCNRMSSHTETSSFLQTLTGRL
PTKKLFHEELALQWVVCSGSVRESALQQAWFFFELMVKSMVHHLYFNDKLDAPRKSRFPE
RFMDDIAALVSTIASDIVSRFQKDTEMVERLNTSLAFFLNDLLSVMDRGFVFSLIKSCYK
QVSSKLYSLPNPSVLVSLRLDFLRIVCSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSS
GFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDPDAEGLFGLHKKVINMVHNL
LSSHDSDPRYSDPQIKARVAMLYLPLIGIVMETVPQLYDFTETHNQRGRPICIATDDYES
ESGSMISQTVAMAIAGTSVPQLTRPGSFLLTSTSGRQHTTFSAESSRSLLICLLWVLKNA
DETVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFERMNSLTFKKSKDMRAKLEEA
ILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNTEKLDKSRAEIEHE
ALIDGNLATEANLIILDTLEIVVQTVSVTESKESILGGVLKVLLHSMACNQSAVYLQHCF
ATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSIGTIRSHASASLYLLMRQNFEIGN
NFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFN
LHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERSNHAEAA
QCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKY
FTETGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKI
VHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVV
EVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLD
GRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFA
THQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTK
RCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVSCHRDSF
SRMSLRKMDL
NT seq 5973 nt NT seq  +upstreamnt  +downstreamnt
atggatccacatgttagagattgtataagaagttatacagaagactgggcaattgtgatc
agaaagtatcataaactgggaacaggatttaatcccaacacattagataaacagaaagaa
aggcaaaaaggtttgccaaaacaggtctttgaatctgatgaagctccggatggcaacagc
taccaggatgagcaggatgatcttaaaagacgttcaatgtcaatagatgatactccaagg
ggaagctgggcctgcagtatctttgacttgaaaaattcacttcctgatgctttgcttccc
aatttacttgatcgaactccaaatgaagaaatagatcgtcagaatgatgatcaaaggaaa
tccaaccgtcacaaggaactctttgctttgcatccatcaccagatgaggaagacccaata
gaacggcttagcgttcctgacgtacccaaagagcattttggtcaaagacttcttgtaaaa
tgtttatcactcaagtttgagattgaaattgagcccatttttgcaagtttggctttatat
gatgtcaaggaaaagaaaaagatttcagaaaacttttattttgaccttaattctgagcag
atgaaaggattattacggccgcatgtaccacctgctgccattaccaccctggcaagatca
gccattttttccatcacttatccttcccaagatgtttttcttgtaataaagctagaaaaa
gtcttacagcaaggggacattggtgaatgtgcagaaccatacatgattttcaaagaagca
gatgccaccaagaataaggaaaaattggagaagctgaaaagtcaagctgatcagttttgc
caaagacttgggaaataccgcatgcctttcgcttggactgcaattcatttaatgaatatt
gttagcagtgctgggagtttagagagagattctacagaagtagaaatcagtactggagaa
cgaaaagggtcttggtcagagaggaggaattctagtattgttggcagacgatcacttgaa
aggacaacaagtggagatgatgcttgtaacctgaccagctttcgtcctgcaactctcaca
gtgacaaatttttttaagcaggaaggagatcgcttaagtgatgaagatctgtacaaattt
cttgctgatatgagaaggccatcttctgtcttacggcgactaagacctattacagctcag
ctgaagatagacatttctcccgcacctgaaaatccttattattgcctaactccagaactg
cttcaagtgaaactttaccctgacagtcgagttaggcctaccagagaaattttagagttt
cctgccagggatgtctatgttccaaacactacttatagaaatcttctctacatataccct
cagagtcttaattttgccaatcgtcaaggttctgccagaaatataacggtgaaagtccag
tttatgtatggagaggatctgagcaatgccatgccggtaatctttggtaaatctagctgt
tcagaattttcaaaggaagcctatacagccgtagtatatcataacaggtctcctgatttc
cacgaagaaatcaaggttaaactccctgccactttaactgaccatcatcacttgcttttt
actttttatcatgttagttgtcaacagaaacaaaatactcctcttgaaaccccagttgga
tatacatggataccaatgcttcagaatggacggttgaagacaggccagttctgcctgccg
gtctcactggaaaaaccgccccaggcctattctgtgctgtctcccgaggttcctctaccg
ggtatgaaatgggtagataatcacaaaggtgtttttaatgttgaagttgttgctgtttca
tctatccatacacaagatccttatcttgacaagttttttgctctggtcaatgctctggat
gaacacatgttccctgtccgaattggggacatgcgcatcatggaaaataacttagaaaat
gaattaaagagcagtatctcagcattgaattcatctcagctggagcccgtggtccgattt
cttcatcttctgcttgataagctgatacttttagttgttagacctcctgtcattgctggc
caaatagtcaatttaggtcaagcatcttttgaagcaatggcatcaattataaatcgactt
cacaaaaacttggagggaaatcaagatcagcatggcagaaacaaccttcttgcatcatat
atctattatgtgtttcgccttccaaatacttaccctaactctccatcaccaggccctggg
ggtttgggaggatcagtgcattatgccacaatggcaagatctgctgtgagacctgcaagc
ctgaatctgaatcgttctcggagccttagtaatagtaacccagatatatccgggaccccc
acgtcacccgacgatgaagtccggtccatcatcggcagtaaggctatggatcgaagttgt
aatcgtatgtcttcgcacacagagacgtcaagtttcttacaaacattaacgggacgctta
ccaactaaaaagcttttccatgaggagctggctttgcagtgggttgtttgcagtggcagc
gttcgggaatcagctttgcagcaggcctggttcttttttgagttaatggtaaagagcatg
gtgcaccacttatactttaatgacaaacttgatgctcctaggaaaagtcgttttccagaa
cggttcatggatgacatagctgctcttgtcagcacgattgctagtgatattgtttcacga
tttcagaaggacacagaaatggttgagagactcaatacaagccttgcattctttctcaat
gatctgttgtctgttatggacagaggatttgtcttcagccttataaagtcctgctataaa
caggtatcttcaaagctttattcattaccaaatccaagtgtcctggtatccttgaggttg
gattttctacggattgtctgcagccacgagcactatgttacgttaaacttaccctgcagc
ttactcacaccccctgcctctccgtcaccttctgtttcttctgcaacatctcagagttct
ggattttccacaaatgtacaagaccaaaagattgcaaatatgtttgagttgtccgtgcct
ttccgccaacagcattatttggcaggacttgtgctgacagagctggctgtcattttagac
cctgatgctgaaggtctgtttggattgcataagaaagtcatcaatatggtacacaattta
ctgtccagtcacgactcagacccgcggtactctgacccccagataaaggctcgggtggcc
atgttgtatctacctctgattggtattgtcatggaaactgtgcctcagctgtacgacttc
acagaaactcacaatcagcgaggaagaccgatttgtatagccactgatgattatgaaagt
gagagcggaagcatgataagtcagacagttgccatggcaattgctggaacgtcagtccct
cagctaacaagaccgggcagtttcctcctcacgtcaacaagtggcaggcagcatactacc
ttttcagcagaatcgagtcggagccttttgatctgtctactgtgggttctcaagaatgca
gatgagacagttctgcaaaagtggtttactgatctctccgtcttacagctaaaccggctg
ctagatctgctttatctctgtgtatcttgttttgagtacaaagggaaaaaggtatttgag
agaatgaatagtttgaccttcaagaaatcaaaggacatgagagcaaagcttgaagaagct
atccttgggagcatcggtgctaggcaagaaatggttcgccgaagccgaggacagcttgag
agaagcccatctggaagtgcctttggaagtcaagaaaatttgaggtggagaaaggatatg
actcactggcggcaaaatacagagaaacttgacaagtcaagagcggagattgaacatgaa
gccctgattgatggaaatctggctacagaagcaaacctaatcattttggatacattagag
attgttgtccagacagtttccgtcacagaatccaaagagagcatccttggtggggtgctg
aaagtgctgctgcacagcatggcctgtaaccaaagcgcagtttatctgcaacactgcttc
gctacacagagggccctcgtctccaagttccctgagctcctgtttgaggaagagaccgag
cagtgtgcggacctatgcctgaggcttctccggcactgcagcagcagcattggtaccata
cggtcgcatgccagtgcctccctttacctgttaatgaggcaaaactttgagatcgggaat
aactttgctagagttaaaatgcaggtgacgatgtcactgtcctccttggtgggcacatct
cagaattttaatgaagaattcttaagacgttctctgaagactatattgacatatgctgaa
gaagatctggaattgagggaaacaacatttcctgatcaggtccaagacctggtttttaat
cttcatatgatcctttctgatactgttaaaatgaaggaacaccaagaggatcctgaaatg
ttgatcgatctaatgtacagaattgccaagggctaccagacctctccagatctgcgactg
acctggttgcagaacatggctggcaagcactccgaacgaagcaatcatgctgaagccgca
cagtgcctggtccactcggcagcacttgttgctgagtacctgagcatgctggaggaccgg
aaatacctccctgtgggatgcgtgacattccagaatatttcatctaacgttttagaagaa
tctgcagtctcagatgatgtggtatctccagatgaagaaggtatctgctctggaaagtac
tttactgaaacaggacttgtgggattactggaacaagcagctgcttccttctctatggct
ggcatgtatgaagcagttaatgaggtttacaaagtacttattcctattcacgaagctaat
cgagacgcaaagaagctctccacaattcatggtaaacttcaagaagcattcagcaaaatt
gttcatcaggatggtaagcggatgtttggcacctattttcgtgttggtttttatggaacc
aagttcggggatttggatgaacaggaatttgtttacaaggaacctgcaataaccaaactt
gcagagatatctcacagattggagggattttatggagaaagatttggagaggatgtggtt
gaagtaatcaaggactctaatcctgtagacaagtgtaaattagatcccaacaaggcatat
attcagattacctacgtggagccatactttgacacatacgagatgaaggacagaatcacg
tattttgacaaaaattataatcttcgccgtttcatgtactgtacacctttcacgttagat
ggtcgtgcccacggggaacttcatgaacagttcaaacggaagaccattctaactacttcc
catgcctttccttatattaaaacaagggtcaatgtcactcacaaagaggagattatttta
acaccaattgaagttgctattgaagacatgcagaaaaagacacaagagttggcatttgca
acacatcaggatccagcggaccccaaaatgcttcagatggtactccagggatctgtaggc
acaacagtgaatcaggggcctttggaagttgcccaggttttcctttctgaaatacccagc
gacccaaaactcttcagacatcataataaacttcgactctgctttaaagattttactaaa
aggtgtgaggatgccttaagaaaaaataagagcttaatcggtccagatcaaaaggagtat
caaagagaactggagagaaactaccatcgccttaaagaagccctccagccactaataaac
agaaagatccctcagttatacaaggcggtactgcctgtctcctgccacagagattccttc
agtcgaatgagccttcgcaaaatggatctctaa

DBGET integrated database retrieval system