KEGG   Tupaia chinensis (Chinese tree shrew): 102497973
Entry
102497973         CDS       T02978                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01523  Antifolate resistance
tup04010  MAPK signaling pathway
tup04060  Cytokine-cytokine receptor interaction
tup04061  Viral protein interaction with cytokine and cytokine receptor
tup04064  NF-kappa B signaling pathway
tup04071  Sphingolipid signaling pathway
tup04150  mTOR signaling pathway
tup04210  Apoptosis
tup04217  Necroptosis
tup04350  TGF-beta signaling pathway
tup04380  Osteoclast differentiation
tup04612  Antigen processing and presentation
tup04620  Toll-like receptor signaling pathway
tup04621  NOD-like receptor signaling pathway
tup04622  RIG-I-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04640  Hematopoietic cell lineage
tup04650  Natural killer cell mediated cytotoxicity
tup04657  IL-17 signaling pathway
tup04660  T cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04668  TNF signaling pathway
tup04920  Adipocytokine signaling pathway
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04940  Type I diabetes mellitus
tup05010  Alzheimer disease
tup05014  Amyotrophic lateral sclerosis
tup05132  Salmonella infection
tup05133  Pertussis
tup05134  Legionellosis
tup05135  Yersinia infection
tup05140  Leishmaniasis
tup05142  Chagas disease
tup05143  African trypanosomiasis
tup05144  Malaria
tup05145  Toxoplasmosis
tup05146  Amoebiasis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05205  Proteoglycans in cancer
tup05310  Asthma
tup05321  Inflammatory bowel disease
tup05322  Systemic lupus erythematosus
tup05323  Rheumatoid arthritis
tup05330  Allograft rejection
tup05332  Graft-versus-host disease
tup05410  Hypertrophic cardiomyopathy
tup05414  Dilated cardiomyopathy
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102497973 (TNF)
   04350 TGF-beta signaling pathway
    102497973 (TNF)
   04064 NF-kappa B signaling pathway
    102497973 (TNF)
   04668 TNF signaling pathway
    102497973 (TNF)
   04071 Sphingolipid signaling pathway
    102497973 (TNF)
   04150 mTOR signaling pathway
    102497973 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102497973 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102497973 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102497973 (TNF)
   04217 Necroptosis
    102497973 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102497973 (TNF)
   04620 Toll-like receptor signaling pathway
    102497973 (TNF)
   04621 NOD-like receptor signaling pathway
    102497973 (TNF)
   04622 RIG-I-like receptor signaling pathway
    102497973 (TNF)
   04625 C-type lectin receptor signaling pathway
    102497973 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    102497973 (TNF)
   04612 Antigen processing and presentation
    102497973 (TNF)
   04660 T cell receptor signaling pathway
    102497973 (TNF)
   04657 IL-17 signaling pathway
    102497973 (TNF)
   04664 Fc epsilon RI signaling pathway
    102497973 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102497973 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102497973 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102497973 (TNF)
  09163 Immune disease
   05310 Asthma
    102497973 (TNF)
   05322 Systemic lupus erythematosus
    102497973 (TNF)
   05323 Rheumatoid arthritis
    102497973 (TNF)
   05321 Inflammatory bowel disease
    102497973 (TNF)
   05330 Allograft rejection
    102497973 (TNF)
   05332 Graft-versus-host disease
    102497973 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102497973 (TNF)
   05014 Amyotrophic lateral sclerosis
    102497973 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102497973 (TNF)
   05410 Hypertrophic cardiomyopathy
    102497973 (TNF)
   05414 Dilated cardiomyopathy
    102497973 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102497973 (TNF)
   04940 Type I diabetes mellitus
    102497973 (TNF)
   04932 Non-alcoholic fatty liver disease
    102497973 (TNF)
   04931 Insulin resistance
    102497973 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102497973 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102497973 (TNF)
   05135 Yersinia infection
    102497973 (TNF)
   05133 Pertussis
    102497973 (TNF)
   05134 Legionellosis
    102497973 (TNF)
   05152 Tuberculosis
    102497973 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102497973 (TNF)
   05170 Human immunodeficiency virus 1 infection
    102497973 (TNF)
   05164 Influenza A
    102497973 (TNF)
   05161 Hepatitis B
    102497973 (TNF)
   05160 Hepatitis C
    102497973 (TNF)
   05168 Herpes simplex virus 1 infection
    102497973 (TNF)
   05163 Human cytomegalovirus infection
    102497973 (TNF)
   05169 Epstein-Barr virus infection
    102497973 (TNF)
   05165 Human papillomavirus infection
    102497973 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102497973 (TNF)
   05144 Malaria
    102497973 (TNF)
   05145 Toxoplasmosis
    102497973 (TNF)
   05140 Leishmaniasis
    102497973 (TNF)
   05142 Chagas disease
    102497973 (TNF)
   05143 African trypanosomiasis
    102497973 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102497973 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tup04052]
    102497973 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102497973 (TNF)
Cytokines and growth factors [BR:tup04052]
 Cytokines
  Tumor necrosis fators
   102497973 (TNF)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Haparin
  Cytokines
   102497973 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 102497973
NCBI-ProteinID: XP_006154315
UniProt: L9KH66
Position
Un
AA seq 235 aa
MSTENMILDVHLAEEALPKKAGGPQSSRRCMLLSLLSFLLVAGATTLFCLLHFGVIGPQK
EEQLPDGLRLVNPLTQTLTLRSSGIPSDKPAAHVIANPQNKGELQWLNRRANTLLANGMQ
LVDNQLVVPSDGLYLIYSQVLFTGLGCPSTPVLFTHTVSCVAVSYNNKVNLLSAIKSPCQ
KETAEGAEAKPWYEPIYQGGVFQLQKGDRLSAEVNLPRYLDFAESGQVYFGVIAL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagcactgaaaacatgatcctcgacgtgcatctggctgaggaggcactccccaagaaa
gcaggggggccccagagctccaggcgctgcatgctcctcagcctcctctccttcctgctc
gtggcaggggccaccacgctcttctgcctgctgcacttcggtgtcatcggcccccagaaa
gaagagcagctcccagacggcctccgcctagtcaaccctctgacccagacgctcaccctc
agatcatctggaatcccgagtgacaagcctgcggctcacgttatagcaaacccccaaaac
aagggggagctccagtggctgaaccggcgtgccaacaccctcctggccaacggcatgcag
ctggtagacaaccagttggtggtgccttccgacgggctgtacctcatctactcccaggtc
ctcttcacgggcctgggctgcccctccacccctgtgctgttcacccacaccgtcagctgc
gttgcggtctcctacaacaacaaggtcaacctcctctctgccatcaagagcccctgccag
aaggagaccgcagagggggctgaggccaagccctggtacgagcccatctaccagggaggg
gtcttccagctgcagaagggtgacagactgagcgccgaggtcaacctgcctcgctacctg
gactttgctgaatctgggcaggtctattttggggtcattgccctgtga

DBGET integrated database retrieval system