KEGG   Tupaia chinensis (Chinese tree shrew): 102498690Help
Entry
102498690         CDS       T02978                                 

Gene name
HSPA6
Definition
(RefSeq) heat shock protein family A (Hsp70) member 6
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup03040  Spliceosome
tup04010  MAPK signaling pathway
tup04141  Protein processing in endoplasmic reticulum
tup04144  Endocytosis
tup04213  Longevity regulating pathway - multiple species
tup04612  Antigen processing and presentation
tup04915  Estrogen signaling pathway
tup05134  Legionellosis
tup05145  Toxoplasmosis
tup05162  Measles
Brite
KEGG Orthology (KO) [BR:tup00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102498690 (HSPA6)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102498690 (HSPA6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102498690 (HSPA6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102498690 (HSPA6)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102498690 (HSPA6)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102498690 (HSPA6)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102498690 (HSPA6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102498690 (HSPA6)
  09172 Infectious disease: viral
   05162 Measles
    102498690 (HSPA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102498690 (HSPA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102498690 (HSPA6)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tup03041]
    102498690 (HSPA6)
   03009 Ribosome biogenesis [BR:tup03009]
    102498690 (HSPA6)
   03110 Chaperones and folding catalysts [BR:tup03110]
    102498690 (HSPA6)
   04131 Membrane trafficking [BR:tup04131]
    102498690 (HSPA6)
   03051 Proteasome [BR:tup03051]
    102498690 (HSPA6)
   03029 Mitochondrial biogenesis [BR:tup03029]
    102498690 (HSPA6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102498690 (HSPA6)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     102498690 (HSPA6)
Spliceosome [BR:tup03041]
 Complex B
  Other components
   Prp19 complex
    102498690 (HSPA6)
 Complex C
   Prp19-CDC5 complex
    102498690 (HSPA6)
Ribosome biogenesis [BR:tup03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    102498690 (HSPA6)
Chaperones and folding catalysts [BR:tup03110]
 Heat shock proteins
  HSP70 / DNAK
   102498690 (HSPA6)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    102498690 (HSPA6)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    102498690 (HSPA6)
Proteasome [BR:tup03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102498690 (HSPA6)
Mitochondrial biogenesis [BR:tup03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    102498690 (HSPA6)
Exosome [BR:tup04147]
 Exosomal proteins
  Proteins found in most exosomes
   102498690 (HSPA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF2336 DUF1464 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 102498690
NCBI-ProteinID: XP_006142288
UniProt: L9L755
Position
Un
AA seq 643 aa AA seqDB search
MSSPREVAIGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDSAKSQ
AALNPHNTVFDAKRLIGRKFADATVQSDMKHWPFQVVSDGGKPKVRVSYRGEDKAFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERHVLIFDLGGGTFDVSVLTIDAGVFEVKATAGDTHLGGEDFDNRLV
SHFVEEFRRKQGKDVSRNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDHQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVREAEQYKAEDEAQRDRVAA
KNSLEAHVFHVMGSLQEESLRDKIPEEDKRTVQDKCQEVLAWLEHNQLAEKEEYEHQKRE
LEQTCRPVFSRLYGGAGVPGGSSCGAQARQGAPSTGPIIEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccccgagagaagtggcgatcggcatcgacctgggcaccacgtattcgtgcgtg
ggcgtgttccagcagggccgagtggagatcctagccaatgaccagggcaaccgcaccacg
cccagctacgtggccttcaccgacaccgagcggctggtgggcgactcggccaagagccag
gcggccctgaacccgcacaacacggtgttcgacgccaagcggttgatcgggcgcaagttc
gcggacgcgaccgtgcagtcggacatgaagcactggcccttccaggtggtgagcgacggc
ggcaagcccaaggtgcgcgtgtcctaccgcggggaggacaaggccttctaccccgaggag
atctcgtccatggtgctgagcaagatgaaggagaccgctgaggcgtacctgggccagccc
gtcaagcacgctgtgatcacggtgcccgcctacttcaacgactcgcagcgccaggccacc
aaggacgcgggtgccatcgcggggctcaacgtgctgaggatcatcaacgagcccacggcg
gccgccatcgcctacgggctggaccggcggggcgcgggagagcgccacgtgctcatcttt
gacctgggtgggggcaccttcgacgtgtcggtcctcacgatcgacgccggtgtctttgag
gtgaaggccaccgccggagacacccacctgggtggagaggacttcgacaaccggctggtg
agccacttcgtggaggagttccggaggaagcaggggaaggacgtgagcagaaacaagcgc
gccctgcgcaggctgcgcacggcctgcgagcgcgccaagcgcaccctgtcctccagcacc
caggccacgctggagatcgactcgctgttcgagggggtggacttctacacgtccatcact
cgtgctcgctttgaggagctgtgctcagacctcttccgcagcaccctggagccggtggag
aaggctctgcgggatgccaagctggacaaggcccagatccacgatgtggtcctggtgggc
ggctccacccgcatcccgaaggtgcagaagctgctgcaggacttcttcaacggcaaggag
ctgaacaagagcatcaaccccgacgaggcagtggcctacggggcggcggtgcaggctgcc
gtgttgatgggggacaagtgtgagaaagtgcaggatctcctgctgctagacgtggctccc
ctgtccctggggctggagacggcagggggcgtgatgaccacgctgatccagaggaacgcc
accatccccaccaagcagacccagaccttcaccacgtactctgaccaccagcctggggtc
ctgatccaggtgtatgagggcgagagagccatgacccgcgacaacaacctgcttgggcgc
tttgagctcagtggcatccctcctgccccgcgtggagtcccccagatcgaggtgaccttt
gacattgatgccaacggcatcctgagcgtgacagccaccgacaggagcacaggcaaggcg
aacaagatcaccatcaccaatgacaagggccggctgagcaaggaggaggtggagaggatg
gttcgtgaggccgagcagtacaaggctgaggacgaggcccagagggacagggtggctgcc
aagaactccctggaggcccacgtcttccatgtgatgggctctttgcaagaggaaagcctt
agggacaaaattcccgaagaggacaaacgtacagtgcaagacaagtgtcaggaagtcctc
gcctggctagagcacaaccagttagcagagaaggaggagtatgagcatcagaagagggag
ctggagcagacatgtcgacccgtcttctccagactctacgggggggctggtgtccctggg
ggcagcagctgtggggctcaagcacgccagggggcccccagtacaggccccatcattgag
gaggttgactga

DBGET integrated database retrieval system