KEGG   Tupaia chinensis (Chinese tree shrew): 102498926Help
Entry
102498926         CDS       T02978                                 

Gene name
ESPL1, Separin
Definition
(RefSeq) extra spindle pole bodies like 1, separase
  KO
K02365  separase [EC:3.4.22.49]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04110  Cell cycle
tup04114  Oocyte meiosis
tup05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:tup00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102498926 (ESPL1)
   04114 Oocyte meiosis
    102498926 (ESPL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102498926 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102498926 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102498926 (ESPL1)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     102498926 (ESPL1)
Peptidases and inhibitors [BR:tup01002]
 Cysteine peptidases
  Family C50: separase family
   102498926 (ESPL1)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    102498926 (ESPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 102498926
NCBI-ProteinID: XP_006169183
Position
Un
AA seq 2127 aa AA seqDB search
MRNFKGLNFGTLLSSQKETKELLPDLKEFLSRPSAGLPSCRSDAEKRQACDAILRACNQQ
LTAKLDCPGHLESLLELAKLACDGYLLSTPQRPPLYLERILFILLRNVAGQGSPEAMFHL
AQPLHACLMQCSRQAAPQDYDAVARGSFSLLWKGAEALMERRAAVSARLKALSFLVLLED
GSTPCEIPHFASPTACRVVAAHQLFDAGGHSLSEADADFLDDLLSRHVIRALVGEGVGSP
EPLSPQKALCLLELTLEHCRHLCWRHHLNKATSTVEKAHVYLRNTSLAPSLKLCQLGVEL
QQTGEERPQAVAKLLIKASAVLNSSMEAPSPPLRALYDCCQFFLSGLDRGIKRRYGLNAI
LSLFAFLRGYFSLIQQLRDDGVRGDFSKQQQSLLQGYFQGLHLYTVVVYDFAQGCQVTDL
TDLAQLVESCKSTVVWMLEALEGLSGRELTDYLGMTASYTSNLTYSFYSHKLYAEACAIS
EPLCQHLGLAKPGTYPAVPPEKLHRCFRLHVESLKKLGKQVEGCTMVTLWLAALRSYSPE
HMVEPVTFWVRVKMDAARAGDKELQLKTLRDSLSGWDPETLALLLQEELQAYKAVRANTG
QERFNVICDLLELSPEETPAGAWARATHLVELAQVLCYHDFAQQTNCSALDAIQEALQLL
ESVKPEAQAEGQLLDDKAQALLWFYICTLEAKMQEGIERDRRAQAPSNLEEFEVNDLNYE
DKLQEDRFLYSNIAFNLAADAAQSKCLDQALALWKEVLTKEQAPAMRCLQQTAASLQILA
ALYELVAKPLQALEVLLLLRIVSERLNDRAKAAGTSCHITRLLHSLGCPSYAQLHLEEAK
LSLKCLDQTTDTHLLLSLTCDLLQSQLYWTQQKVTEGISLLLTVLRDPALQKSSKAWYLL
RVQALQLVAVYLSLSSDSLSDCLWEQLCAQGWQTPEIALIDSHKLLRSILLLLLGSDVLS
VQKAAVETPFLDYGENLVQKWQVLTEVLSCSEKLVCRLGHLGSVSEAKAFCLEALKLTTK
LQIPRQCALFLVLKGELELARNDMDLCQSDLQQVLFLLESCTEFGGVAQHPDTVKKVHLQ
KRKQKAHVPCPPQLPEEEPFLRGPALELVATVAKEPGPIAPSTNSSPVLKTKPLPSPGFL
SHAPSCDCSLCASPILSAVCLRWVLVTAGVRLAMGHQAEGLDLLQVVLKGCPAATKRLTQ
ALQASLNYKAAPDPVPSLMDGIMAQAYTQLALEGLNQLSNKSLGKVLESGLKFIEERIPH
LEAWRPSLLLIQALAKLASLGCCTTQLFTSSWGWQPPLIKSPVDSEPSKTRNQKRSGRGH
QQAASAPLSLQTTSQKGLEGGGPPCTPKPPGRVRPAGPRVPFTVFEEVFLTKSKPEVPQA
PRVQRRVQTRLKVNFSDDSDLEDPVSAEARLAEEPKRRGTVCRGRGRGRSRKGPSLKPSA
VAAPDSAPGRPRLSVRSRKAKKVSSGHSEEQEILCGQARLGPEIMRTIPEEELTDNWMEM
SFEILRGSDGEDSASGGKAPALGPDTVIGEREVLRRDVSKEELSISCPDKESDRDLGLRL
CLPPAPIVIGLPTLDSICASLSTAFRGVSHCPPSGLYAHLCRFLALCLGHRDPCATAFLI
TESVSITCRHQLLTHLHRQFSKAQKHQGSLEMADQLQGLSLQERPGDVPLARIQHLFSFR
TSGSGHFPQPEKERFQEHLALIPSGVTVCILALATLRPGIVGDTLLLTRLEKDNPPVTVQ
IPTAQNKLSLSLALKEFDAIQKEQKENSSCTDKREWWTGRLELDHRMEVLVTSLEKYVLG
CWRGLLLPSNEEPSSVQEASRLQGLLQDCGWKYPDPTLLKIMLSGASTLTPQDIQALACG
LCPTQPERAQELLNESVGRLRGQTVPSNRHLVLVLDKDLQKLPWESMPSLRARPVTRLPS
FHFLLSYSIIKESGASSVLSQGVDPRSTFYVLNPHNNLSSTEEQFRATFSSEAGWRGVIG
EVPSPEQVQAALTERDLYIYAGHGAGARFLDGQAVLRLGCRAVALLFGCSSAALAVHGNL
EGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVSQARQAP
RLKYLIGAAPVAYGFCFCDNPLELSYC
NT seq 6384 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacttcaaaggactcaactttgggactctgctaagcagccaaaaagagacgaaa
gagttgctgcctgatttgaaggagttcctgtccaggccttcagctggtttacccagctgc
cgatctgatgctgagaagagacaagcttgtgatgccatcctgagggcttgcaaccagcag
ctgactgccaagctagattgccctggacacctagagagcctgctggagctggcaaagctg
gcctgtgatggctacttgctgtccaccccccagcgccctcccctctacctagaacgaatt
ctcttcatcctgctgcggaacgttgctgggcagggaagcccagaggccatgttccacctt
gctcagcccctccatgcctgtttgatgcagtgctctcgccaagctgccccccaggactat
gacgctgttgctcggggcagcttttctctgctttggaagggcgcagaagccctgatggag
cggcgagctgcagtctcagctcggctaaaggccttgagcttcttagtacttttggaggat
ggaagtaccccttgtgagattcctcactttgcttctccaacagcctgtcgagtggtagct
gcccatcagctatttgatgccggtgggcatagtctgagtgaagcagatgctgatttccta
gatgatctgctctccagacatgtgatcagagccttggtgggtgagggagtgggctctcct
gaacctctttctccacagaaggccctctgcctcttggagctcaccttggaacactgccgt
cacctctgttggagacaccacctcaacaaagccaccagcacagtggagaaggctcatgtt
tatctaaggaacaccagtctagcccccagccttaagctatgccagctgggggttgagctg
cagcagactggggaggaaagaccccaggcagtggccaaacttctgatcaaagcatcagct
gtcctgaacagcagtatggaggcaccatcacccccacttcgggcattgtatgactgctgc
cagttcttcctctcaggcctggatcgaggcatcaagaggcgctatgggcttaatgctatt
ctgagcctctttgctttccttcgagggtacttctctcttatccagcagctgcgggatgat
ggtgtccgtggggatttctccaagcagcagcagtctttgctccaggggtactttcaggga
cttcacctctacactgtggtggtttatgactttgcccaaggctgtcaggtaactgattta
actgacctggcccaactagtggagagttgcaagtctactgttgtctggatgctggaggcc
ttagagggcctgtcaggccgagagctgactgactacctagggatgactgcctcctacacc
agtaacttgacctacagcttctatagtcacaagctctatgccgaggcctgtgccatctct
gagccgctctgtcaacacctgggtttggcgaagccaggcacttacccagcggtgcctcct
gagaagttgcacagatgcttccggctgcatgtagagagtttgaagaaactcggtaaacag
gtcgagggctgcactatggtgactttgtggctggcagccctgcggtcctatagccccgag
cacatggttgaaccagttaccttctgggttcgagtcaagatggatgctgccagagctgga
gacaaggagctgcagctaaagacgctgcgagatagcctgagtggctgggatccggagacc
ctggccctcctgctgcaggaggagctgcaggcctacaaggcggtgcgagccaatactggg
caggaacgcttcaacgtcatctgtgacctgctggaactgagccccgaggagacaccagcc
ggggcatgggcacgagccacccacctggtggagctggctcaggtgctctgctaccatgac
tttgcccagcagaccaactgctctgccctggatgctattcaggaagccctgcagcttctg
gagtctgtgaagccagaggcccaggccgagggtcagcttctggatgataaagcacaggcc
ttgctgtggttctacatctgtaccctggaggccaaaatgcaggaaggtattgagcgtgat
cggagagcccaggcccctagtaacctggaggaatttgaagtcaacgacctgaactatgaa
gataaacttcaggaagatcgtttcctgtacagtaacattgccttcaacttggctgcggat
gctgctcagtcaaaatgcctggaccaagccctggccctgtggaaggaggtgcttacaaag
gagcaggccccagccatgcggtgtctccagcagacagcagcctctctgcagatccttgca
gccctctacgagctggtggcaaagcccctgcaggctctggaggtcctgctgcttctacgg
attgtctccgagagactgaacgaccgcgcaaaggcagctggcacctcttgccacatcacc
cggctcctgcactccctcggctgtcccagctatgcccagttacatctggaagaggcaaaa
ttgagcctaaaatgtctggatcagaccactgacacgcacctgctcctttctctgacctgc
gatctacttcaaagtcaactctactggactcagcagaaggtaactgagggtatctccctg
ctgctcactgtccttcgggatcctgccctccagaagtcgtccaaggcttggtacctgttg
cgtgtccaggccctgcagctggtggcagtctaccttagcctgtcctcagacagcctctca
gactgcctgtgggagcagctctgtgcccaaggctggcagacacccgagatagccctcatt
gactcccataaactcctccgaagcatcctcctcctgctgctgggcagtgatgtactctca
gttcagaaagcagctgtggagacaccgtttctggactacggtgaaaatctggtacaaaaa
tggcaagttctcacagaggtgctgagctgctcagagaagcttgtctgccgcctgggccac
ctggggagtgtgagtgaagccaaggccttttgtttagaggccctgaaacttacaacgaag
ctgcagatacctcgccagtgtgccctgttcttggtgctgaagggtgagctggagctggcc
cgcaatgacatggacctctgccagtctgacctgcagcaggtcctgttcttgcttgagtct
tgcacagagtttggtggggtagcccagcacccggacactgtgaagaaagtccacttgcag
aaaaggaagcagaaggcccacgtgccctgtcctccacagctcccagaggaggaacctttt
ctgagaggccctgccctggagctggtggccacagtggccaaggagccaggccccatcgcc
ccatctacaaactcctccccagttctaaaaaccaagcccctacccagtcctggcttcctg
tcccatgctccctcctgtgactgctcactctgtgccagccccatcctctcggcagtctgt
ctgcgctgggtattggtcacagcaggggtgaggctggccatgggccatcaggccgagggt
ctggatctgctgcaggttgtgctgaagggttgccctgcagccaccaagcgcctcacccaa
gctctccaagcttccctgaattacaaagcagcccctgaccctgtcccgagcctcatggat
gggatcatggctcaggcatacacacagctggcactggagggcctgaaccaactatcaaac
aagagcctgggaaaggtcctggagtcagggctaaagttcatagaggagcggataccccac
ctggaggcctggagacccagcctgcttttgattcaggccctcgcaaagctggccagcctc
ggctgctgcactacccaactttttacaagctcctggggttggcagccaccattaataaaa
agccccgtagactcagagccctcaaagactcggaaccaaaaacgatctggacgagggcac
caacaggcagcctctgcccccctgtccctccagactacctctcagaaaggtctagaaggt
ggaggaccaccctgtacacctaagcctccaggccgggtcagaccggccggccctcgtgtc
cccttcacggtattcgaggaagtcttcctcacaaagagcaagcctgaagttccccaggct
ccgagggtacagcggagggtccagacgcgcctcaaggtgaacttcagtgatgacagtgac
ttggaagaccctgtctcagctgaggcacggctggcagaggagcctaagagacggggcact
gtttgtcggggccggggccggggccggtctaggaagggcccgagtttgaagcctagtgca
gtggctgccccagatagtgcccctgggcgccctaggttgagtgtcaggagccggaaggcc
aagaaggtgtcatcaggacattctgaggagcaggagatcctttgtggccaggccaggctg
ggtcctgagatcatgaggaccatccctgaggaagaactgactgacaactggatggaaatg
agctttgagatcctcaggggctctgatggggaagactcagcctcaggtgggaaggcccca
gctctaggccctgatacagttataggagaacgtgaggtgctgagacgagatgtcagcaag
gaggagttgtctatctcgtgcccagacaaggagagcgacagggacctcggtcttcggctc
tgtctccccccggcccctatagtcattggtctccctaccctggattccatctgtgcctca
ctgagcactgctttccgtggagtcagtcactgccctcccagtgggctgtatgcccacctc
tgtcgcttcctggccttgtgcctggggcaccgggatccctgtgccactgccttccttatc
actgagtcggtctccatcacctgtcgccaccagctgctcacccacctccacagacagttc
agcaaggctcagaagcaccaaggatcactggaaatggcagaccagctgcaggggctgagc
ctccaggagagacctggagatgtccccttggcccgcatccagcacctcttttccttcagg
acttcaggatctggccatttcccccagcccgagaaggagcgtttccaagaacacctggct
ctgatccccagtggggtgactgtgtgtatactggccttggccaccctccggcccggaatc
gtgggcgacaccctcctgctgacgcggctggaaaaggacaatccccccgtcactgtgcag
atccccactgcccagaataagctttctttaagtttggctctgaaagagtttgacgccatc
cagaaggaacagaaagagaacagcagctgtaccgacaagcgagaatggtggacagggcgg
ctagaactggatcataggatggaggtccttgtcacttccctagagaagtatgtgttgggc
tgctggaggggactgctgttgccatccaatgaggagcccagttctgtgcaggaggcctcc
cgtctgcaagggctgctgcaggactgtggctggaaataccctgaccctactctgctgaaa
atcatgctcagcggtgccagcacactcacccctcaggacattcaggccctagcctgtggg
ctgtgccccacccagccagaacgagcccaagagctcctgaacgagtcagtgggacgtctg
cggggccagacagtgccaagcaacaggcaccttgtcttggtgctagacaaggacctgcag
aagctgccatgggaaagcatgcccagtctccgggcacggcctgtcacccggctgccctct
ttccacttcctactcagctactccatcatcaaagagtctggggcctcatcggtactgagc
caaggggtggatccacgaagtaccttctacgtcctgaaccctcacaataacctgtcaagc
acagaggagcaatttcgagccacttttagcagtgaagctggctggagaggggtgatcggg
gaagtgccgagccctgaacaggtgcaggcagccctgacggagcgcgatttatatatctat
gcaggtcatggggctggcgcccgcttcctcgatggacaagctgtcctgcggctgggctgc
cgggcagtcgccctgctgtttggttgcagcagcgcagccctggctgtacacggaaacctg
gagggggctggcatagtgctgaagtacatcatggccggctgccctttgttcctgggtaat
ctctgggatgtgactgaccgtgacattgaccgctacacggaagctctgctgcagggctgg
cttggagcaggcccaggggccccccttctctactacgtcagccaggctcgccaggctccc
cgactcaagtatcttattggggctgcacctgtagcctatggcttttgcttctgcgataac
cctttggagctgtcttattgctga

DBGET integrated database retrieval system