KEGG   Tupaia chinensis (Chinese tree shrew): 102499553Help
Entry
102499553         CDS       T02978                                 

Gene name
DDC
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00350  Tyrosine metabolism
tup00360  Phenylalanine metabolism
tup00380  Tryptophan metabolism
tup01100  Metabolic pathways
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup05030  Cocaine addiction
tup05031  Amphetamine addiction
tup05034  Alcoholism
Module
tup_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
tup_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102499553 (DDC)
   00360 Phenylalanine metabolism
    102499553 (DDC)
   00380 Tryptophan metabolism
    102499553 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102499553 (DDC)
   04726 Serotonergic synapse
    102499553 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    102499553 (DDC)
   05031 Amphetamine addiction
    102499553 (DDC)
   05034 Alcoholism
    102499553 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102499553 (DDC)
Enzymes [BR:tup01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     102499553 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     102499553 (DDC)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102499553 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102499553
NCBI-ProteinID: XP_006161856
Position
Un
AA seq 490 aa AA seqDB search
MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLLPDTAPQEPETFEDIVNDI
ERIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGQMLGLPEVFLAGKAGEGGGVIQGSASEATLMALLAARTKAIQRLQAASPALTQAAIL
EKLVAYASDQAHSSVERAGLIGGVKLKAIPSDGSFAMRASALQEALERDKAAGLIPFFVV
ATLGTTSCCSFDNLLEVGPVCNKEEVWLHIDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFKLDPVYLKHGHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICAEVTLGLVCFRLKGSNKLN
EALLKRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVRFAWDHICELASSLLAAGRE
QGESAAEIKS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaagtgagttccgaaggagagggaaggagatggtagattatgtggccaactac
atggaaggcatcgagggacgccaggtctaccccgatgtggagcctggctacctgcggccg
ctgctcccggacacggcccctcaggagccagagacatttgaggacatcgtcaatgacatc
gaaagaatcatcatgccaggggtgacccactggcacagcccctacttcttcgcctacttc
cccacggccagctcctaccccgccatgctggccgacatgctgtgcggggccatcggttgc
atcggcttctcctgggctgcgagccccgcctgcacagagctggagaccgtaatgatggat
tggctcggccagatgttggggctgccggaagtgtttctggctgggaaggctggagaaggc
ggaggcgtgatccaggggagtgcaagtgaggccactctgatggctctactggccgctcgg
accaaagcgattcagaggctgcaggcggcctcgccggcactgacacaggccgccattctg
gagaagctggtggcctatgcgtccgaccaggcacactcctcagtggaaagagctggctta
attggtggagtgaagttgaaagccatcccttcagatggcagctttgccatgcgagcgtct
gccctgcaggaggcactggagagagacaaggcagctggcctcatcccattctttgtggtc
gcaacactggggaccacgtcttgctgctcctttgacaatctcttagaagtgggtcctgtt
tgcaacaaggaggaggtgtggctacacatcgatgctgcctacgctggcagcgccttcatc
tgccctgagttccggcatcttttgaacggagtggagtttgcagattcatttaactttaat
ccccacaaatggctgctggtgaattttgactgctctgccatgtgggtgaagaagagaaca
gacctaacgggagcctttaaactggaccctgtctacctgaagcacggccaccaggactca
gggctcatcacggactataggcactggcagataccgctgggccggaggttccgctctttg
aagatgtggttcgtctttaggatgtacggggtcaaaggactgcaggcatacatccgcaag
cacgtccagctctcccatgagttcgaatcgctggtgcgccaggacccccgctttgagatc
tgcgcagaagtcactctggggctggtgtgctttaggctgaagggttccaacaaactgaat
gaagctcttctgaagagaattaacagtgccaagaaaatccacctggttccgtgccacctc
cgagacaagttcgtgctgcgctttgccatctgctctcgcactgtggagtctgcccacgtg
cggttcgcctgggatcacatctgtgagctggccagcagcctgctggcagcagggagggag
caaggcgagtcagctgcagagatcaaaagttga

DBGET integrated database retrieval system