KEGG   Tupaia chinensis (Chinese tree shrew): 102499608Help
Entry
102499608         CDS       T02978                                 

Gene name
MRVI1
Definition
(RefSeq) murine retrovirus integration site 1 homolog
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    102499608 (MRVI1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102499608 (MRVI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRVI1 DUF3270 Nucleo_P87 HIF-1a_CTAD DUF3292
Motif
Other DBs
NCBI-GeneID: 102499608
NCBI-ProteinID: XP_006167496
Position
Un
AA seq 903 aa AA seqDB search
MVKAPQSEERLAGGGKGNNSVLACGAQAFWSISGAGAAEVPGTRSHSRQEAAMPHSPEDE
DPPGDPQATQSPTGQGPPSTGVSYSPPTIVLTGDASSPEEETNKNLANRAHSPHRRLSHR
HLKVSTTSLTSVDPAGHVIDLVNDQLPDISISEEDKQKNLALLEEAKSVSERFLSRRGRK
SRSSPGDSPTAVSPNLSPGASPVSSRSNSLTVPSPPGLDVCSGPQFPLPGAPPQQKEDEA
EVSSPLIGEPNVSKGLADRKQNDQRKVSQGRLTPRSPTLVEKSKEIEIEQKENFDPLQHP
ETTPKGPAPGISSGGKMALNSPQPSAVESELGKQILKTAREGNPLPRSPAQGTGGVAPPT
GEPTGPKVGSKVELRPPVSRPPLLRGVSWDSSPEEPGPRLQKVLAKLPLAEEEKRFSGKA
GGKLAKTPGLKDLQIQVQPVRMQKLTKLREEHILMRNQNLVGLKLPDLSEAAEQEKGLPS
ELSPAIEEEELRSGLDVMPNISDVLLRKLRVHKSLPGSAPPLTEKEVENVFVQLSLAFRN
DSYTLESRISQAERERNLTEENTEKELENFKASITSSASLWHHCEHRETYQKLLEDIAVL
HRLAARLSSRAEMVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEFKKLANQNSS
RSCGPSEDGVPRTARSMSLTLGKNMPRRRVSVAVVPKFNALNLPGQSPSSSPIPSLPTLS
ESSNGKGHLPVTSALPALLENGKTNGDPDCEVSAPLPTPSNLEEGSQEAKARMEEEAYNK
GYQEGLKKTKELQDLKEEEEEQKNESPEETEEVEEIEEENQRSSKLEELVHFLHVMYPKL
CQHWRVIWVMAAMMLVLTVVLGLYNSYNSCVEQAEEPLGRSTCSEAQRDSWWSSGLQHEQ
PTE
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagctccccagagtgaagagaggctggccggaggaggaaaggggaataactca
gttttagcctgcggagcccaggccttttggagcatctctggggctggtgcagcggaggtc
ccgggcacacgcagccactcccgccaggaggctgccatgccccacagtcctgaggatgag
gatccccctggagacccacaggcaacccagagccccaccggccaaggccctccctctaca
ggagtctcttatagtccacccacgattgtcctgactggggatgccagttcaccggaggaa
gaaaccaacaaaaacttggccaacagagctcacagtcctcacaggaggctctctcacaga
cacttgaaggtttccactacgtcgctgacctccgtggaccctgcgggacatgtcattgac
ctggtaaatgaccagcttccggacatcagcatctcagaggaggacaagcagaaaaacctg
gcgctgctggaagaagccaagtcagtgagcgagcggttcctgagccgccgtgggaggaag
tccaggagcagccctggagactccccaacagctgtttccccaaacctcagcccgggagct
tctcctgtttcctctcggagcaactcgctcacagtgccctccccgccagggttggatgta
tgcagtggcccacagttccctctgcccggagcgccaccacagcagaaggaggatgaagct
gaagtctcttcacctctcattggcgagcctaatgtctccaaagggctagctgaccggaag
cagaatgatcaaaggaaagtgtctcagggcaggctgactcctcgctctcctacgcttgtt
gagaagtccaaagagattgaaatagaacaaaaggaaaacttcgatcccctccagcaccct
gagaccacacccaagggcccagcacctggtataagcagtggtgggaaaatggccctgaac
agcccccagcccagcgctgtagagagtgagctggggaagcagatactgaagacagccagg
gagggcaaccccctaccaagaagcccagctcagggcacaggaggggtggctcctcccaca
ggggagcccacaggccccaaggttggctccaaagtggagctgcggccccctgtgtcccgg
cccccactgctgcggggggtctcctgggatagtagccctgaagaacctggtccccggctg
caaaaagtgcttgccaagctgccactggcagaggaagaaaagcgtttttcaggcaaagct
ggcggcaaactggccaagacacctgggctcaaagaccttcagatccaagtgcagcccgtc
cggatgcaaaaactgaccaagctccgcgaggagcacatcctgatgagaaatcagaacttg
gtggggctcaagcttccagaccttagtgaggcagccgagcaggaaaaagggctcccttct
gaactctcaccagctattgaagaggaagaattaaggagtggcttggatgtcatgcccaat
atttctgatgtgctgctgcgcaaactgcgagtccacaagtctctccctggaagtgcccct
ccactcactgaaaaggaagttgagaacgtgtttgtgcaactgtccttggcctttagaaat
gacagctacaccctggaatctagaattagccaggcagaaagagaacgcaacctgacagag
gagaacaccgagaaggaactggaaaacttcaaagcttccattacgtcctcagcttctctc
tggcaccactgtgagcaccgggagacctaccagaagctgctagaggacatcgccgtcttg
catcgcctggctgcccgcctctccagccgagctgagatggtgggcgctgtccgccaggaa
aagcgcatgtcaaaagcaacagaagtgatgatgcagtacgtggagaatctgaagaggaca
tatgagaaggaccatgcggagctcatggagtttaaaaaacttgcaaatcagaattcaagt
cgcagctgtgggccttctgaggatggagtccctcgcacggcacggtcaatgtctctgaca
ctgggaaagaatatgccccgccggagggtcagcgttgctgttgttcccaagtttaatgcc
ctgaacttgcctggccaatctcccagctcatcacccatcccctccttgccaaccctgtca
gaatcatccaatgggaaaggccacctacctgtcacctcagcactacctgcacttttggaa
aatggaaagacaaatggggatccagattgtgaagtctctgctcccctcccaactccgagc
aacctggaggaaggtagtcaggaggctaaggccaggatggaggaagaagcttacaacaag
ggataccaggaaggtctaaagaagaccaaagagcttcaagatctaaaggaggaagaagaa
gaacagaagaatgagagtcccgaggaaactgaagaggtagaagaaattgaggaagagaac
cagagaagcagcaaacttgaagaattggtccatttcttacacgtcatgtatcccaagctg
tgtcagcactggagagtgatctgggtaatggctgctatgatgctggtcttgactgttgtt
cttgggctctacaactcctataactcttgtgtggagcaggccgaggagccccttggaaga
tccacttgctcagaagcccagagggactcctggtggagctcaggactccagcatgagcag
cccacagagtaa

DBGET integrated database retrieval system