KEGG   Tupaia chinensis (Chinese tree shrew): 102500776Help
Entry
102500776         CDS       T02978                                 

Gene name
NSUN2
Definition
(RefSeq) NOP2/Sun RNA methyltransferase family member 2
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tup03016]
    102500776 (NSUN2)
Enzymes [BR:tup01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     102500776 (NSUN2)
Transfer RNA biogenesis [BR:tup03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    102500776 (NSUN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 102500776
NCBI-ProteinID: XP_014441330
Position
Un
AA seq 803 aa AA seqDB search
MASLARSMPRQGTYTAPARGREALVDFGPTRGGKHERPEGAEDATEGSGKRKDAGWEGGY
PEIVKENKLFEHYYQELKIVPEGEWDQFMGALREPLPATLRITGYKSHAKEILHCLKNKY
FKELEDLEVDGQKVEVPQPLSWYPEELAWHTNLSRKILRKSPQLEKFHQFLVSETESGNI
SRQEAVSMIPPLLLSVQPHHKILDMCAAPGSKTTQLIEMLHADMNVPFPEGFVIANDVDN
KRCYLLVHQAKRLSSPCIMVVNHDASCIPRLMIDVDGRKEALFYDRVLCDVPCSGDGTMR
KNIDVWKKWTTLNSLQLHGLQLRIATRGVEQLAEGGRMVYSTCSLNPIEDEAVIASLLEK
SEGALELADVSSELPGLKWMPGITQWKVMTKDGQWFVDWNDVPHSRHTQIRPTMFPPKDP
EQLRAMHLERCLRILPHHQNTGGFFVAVLVKKSPMPWNKRQSQLQGRSAQAREAARSGPA
DLAEGKPPDPSELEGQSVPETDDTEVIQTTENVENNGNKKDGVCGPPPSKKMKLFGFKED
PFVFIPEDDPLFPPIEKFYALDPSFPKMNLLTRTTEGKKRQLYMVSKELRNVLLNNSERM
KVINTGIKVWCRNNSGEEFDCAFRLAQEGIYTLYPFINSRIITVSMEDVKILLTQENPFF
RKLSSEAYSQVKDLAKGSVVLKYEPDSANPDALQCPIVLCGWRGKASIRTFVPKNERLHY
LRMMGLEVLGEKKKEGVILTNANAASSEQPENELTEEQRPEEAELTEEQRPEEVELSGEQ
RTGEADGLDGTTCCDSAGADPPR
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctggcacggtccatgccccggcagggcacatatacggcgccggcgcggggg
cgggaggcgcttgtggactttgggcccacgaggggcgggaagcacgagcggccggagggc
gcggaggacgccaccgagggcagcgggaagcgcaaagatgcgggctgggaaggtggctac
cccgagatcgtcaaggagaataagctgttcgagcactactaccaggagctcaagatcgtg
cccgagggcgagtgggaccagttcatgggcgcactcagggagcccctcccggccacttta
agaatcactggttacaaaagccacgcgaaagagattcttcattgcttaaagaataagtat
ttcaaggaattggaggacctggaggtggatggccagaaagttgaagttccacagccactg
agttggtatcctgaagaacttgcctggcacacaaatttaagtcgaaaaatcttgaggaag
tcaccacaattggaaaagttccatcagtttctggtcagcgaaactgagtctggcaacatc
agtcggcaggaagctgtcagcatgatccccccgctgctgctgagtgtccagccgcaccat
aagatcttagatatgtgtgcagcccctggctccaagaccacgcagttgatcgaaatgctg
catgctgacatgaatgtcccttttccagagggcttcgttattgctaacgatgtggacaac
aagcgttgctacctgctcgttcatcaagccaaaagactgagcagcccctgcatcatggtg
gtcaaccacgatgcgtcctgcatacccaggctcatgatcgacgtggacggaaggaaggag
gcactcttctatgacagagttttatgtgatgtgccttgcagtggagatggcactatgaga
aaaaatattgatgtttggaaaaagtggaccaccttaaacagcttgcagctacatggctta
cagttgaggattgcgacccgaggtgtcgagcagcttgcggagggggggcggatggtgtac
tccacgtgctcactcaaccccattgaggacgaggcggtcatagcatcgttactggagaaa
agcgaaggcgccctggagctcgccgacgtgtcctccgaattgccaggtctgaagtggatg
ccgggaatcacacagtggaaggtaatgacgaaggatggacagtggttcgtggactggaat
gatgttcctcacagcagacacacccagattcggcccaccatgttccccccaaaggacccg
gaacagttacgagcgatgcatctggagcggtgccttaggatattaccacatcatcagaac
actggcggcttctttgtggccgtattagtcaaaaagtctccaatgccgtggaataaacgg
caatcccagctgcagggtcgatctgcacaggccagagaagctgcccggtcgggccctgcg
gacctggcagaggggaagcccccagacccctctgagctggaaggtcagtcagtccctgaa
actgacgacacagaagtaattcaaacaactgagaatgtagagaataatggaaataagaaa
gatggcgtgtgtggccctcctccgtcaaagaaaatgaagttatttggatttaaagaagat
ccatttgtattcattcctgaagatgacccattgtttccacctattgagaaattttatgca
ttggatccttcattcccaaagatgaatttgttaactcggactacagaagggaagaaaagg
caactctacatggtttccaaggaactgagaaacgtgctgctcaataatagtgagaggatg
aaggttattaacacgggtatcaaggtctggtgtcggaataacagtggtgaagagtttgac
tgtgctttccggctggcacaagagggaatatatacactctatccatttattaactcaaga
attattactgtatcgatggaagacgttaagatactgttgacccaggaaaatccatttttt
agaaaactcagcagtgaagcatacagtcaagtcaaggacctggcaaagggaagtgtcgtg
ctgaagtatgaaccggattctgcgaacccagatgctctgcaatgtcccattgtgttatgt
ggatggcggggaaaggcctcaattcgaacttttgtgcccaagaatgaacggcttcattat
ctcaggatgatggggctagaggtgttgggagaaaagaagaaagaaggggttattctaaca
aatgccaatgcggccagctccgagcagccagagaatgagctgactgaggagcagagaccg
gaagaggccgagctgactgaggagcagagaccagaggaggtggagctgagtggggagcag
agaacaggagaggccgacggcctggacgggacgacgtgctgtgattctgctggggccgac
ccgccccggtaa

DBGET integrated database retrieval system