KEGG   Tupaia chinensis (Chinese tree shrew): 102503138
Entry
102503138         CDS       T02978                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102503138 (AHRR)
Transcription factors [BR:tup03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102503138 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3
Other DBs
NCBI-GeneID: 102503138
NCBI-ProteinID: XP_014441767
Position
Un
AA seq 752 aa
MIPPGECTYAGRKRRKPVQKQRPAVGTEKSNPSKRHRDRLNAELDHLASLLPFPPDVISK
LDKLSVLRLSVSYLRVKSFFQAVQKCSRQPVASTPLPGSGGPHTVSVVPEGRLLLESLNG
FALVVSAEGVIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCQQLHWAMDPPQVV
FGQPLHPETGEDAILGRLLRAQEADADLPTEYSAFLTRCFACRVRCLLDSTSGFLTMQFQ
GKLKFLLGQQKKAPSGTALPPRLSLFCVVVPVLLPSVAEMKMKSVFLRAKHRADPVATMD
TKVKAPPRPCVPELPRKRAHVAGRSNGEACVPVFRAQMDAVRCPRVLTQAPCLCLRGGPD
LAPQGAARVKAPPRPCVPELPRKRAHVAGRSNGEACVPVFRAQMDAVRCPRVLTQAPCLC
LRGGPDLAPQGAARHGEEEEPECVLSGSCGLRSCREIHGDGCLVETPGPSRRPTLVSEER
SQEAIRLQLHSSSSGLFSACAAPHPGIQSTFQGGSAAFRSPPISRAPSHYPRACSGRLST
HLRGLGQGQGQVPPPTRHVPQCSLESQLPPPGAQRFTVGGYSTADSLPVPAGAPCSPMLS
LDVPIKMESDSGPEDTADGYAWLGASGVATRPLVTFPTRLHLKTEPGPRSQGCTPYHGHS
LLGPQPHGRAGRELATFCLAHCACLERLHSPLEQQPSTPGCGCRAPGAVPVVKREPLDSP
LWAAPSQVGVPRVFPRSALAIPPEASECTSLL
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgatcccaccaggcgagtgcacgtatgctgggaggaagaggaggaagcctgtccagaaa
cagaggcctgctgtggggacagagaagtcaaacccttccaagcggcaccgggaccgcctc
aacgcagagctggaccacctggccagcctgctgcccttcccccccgatgtcatctccaag
ctggataagctgtccgtcctgcgcctcagcgtcagctacctccgggtgaagagctttttc
caagctgtgcagaagtgctcgaggcagcccgtggccagcacgcccttgcccggatctggg
ggtccccacacagtgtcagtggtgccggaggggaggctgctgctggagtctctcaacggc
ttcgctctggtcgtgagcgcggaaggcgtgatcttttatgcgtcggcaacaatcgtggac
tacctgggcttccatcagacggatgtcatgcaccaaaacatttatgactacatccacgtg
gatgaccgtcaggacttctgccagcagctgcactgggccatggaccctccccaggtggtg
ttcgggcaacccctgcacccagaaacaggagaagatgcaatcctggggaggctactcagg
gcccaagaggcggacgcggacctgcccaccgagtactcggccttcctgacccgctgtttt
gcctgccgtgtgcgctgcctgctagacagcacctcgggcttcctgacgatgcagttccaa
ggaaaactgaagttcctgttggggcagcagaagaaggcgccctcagggacagccctgccc
ccgcggctctcgctcttctgtgttgtggtgcccgttctcctgccttctgtggccgagatg
aaaatgaagagtgtgtttctgagagcaaagcacagggcagaccctgtggccaccatggac
acaaaggtgaaagcgccccccaggccgtgtgtgcccgagttgcccaggaagcgcgctcac
gtggcaggacgaagcaatggcgaagcctgtgttcccgtgttcagggcacagatggacgct
gtccgctgccctcgggtcctgacccaggccccatgcttatgcctcaggggcggccctgac
ctggccccccagggggctgcaagggtgaaagcgccccccaggccgtgtgtgcccgagttg
cccaggaagcgcgctcacgtggcaggacgaagcaatggcgaagcctgtgttcccgtgttc
agggcacagatggacgctgtccgctgccctcgggtcctgacccaggccccatgcttatgc
ctcaggggcggccctgacctggccccccagggggctgcaaggcatggggaggaggaggag
ccggaatgcgtgctgagtggctcctgtggactgaggagctgcagggagatacatggggac
ggctgcctcgtggagacgccaggaccctcaaggcgcccaaccctggtgtcagaggagcgc
agccaggaggccatcaggctgcagctgcactccagcagtagtggcctgttctccgcctgt
gctgcaccccacccaggcatccagagcactttccaagggggctctgctgctttcagaagc
ccgcccatctcccgagcgcccagccactatccccgggcctgctctggcaggctaagcaca
cacctgcgggggctaggccagggccagggccaggtgccccctcccacccgccacgtcccg
cagtgcagccttgagagccagctccccccgcctggagctcagcgtttcacggtgggcggc
tactccaccgctgacagtctgcccgtgcccgctggagccccgtgcagcccgatgctgtca
ctagacgtgcccatcaagatggagagtgactctgggcctgaggacacagcagacggctat
gcctggctgggggccagtggtgtggccacaaggcctctggtcacgttccccaccaggttg
catctgaagacagagccaggccccaggtctcagggctgcactccataccacgggcacagc
ctgctggggcctcagccccacggcagggccggcagggagctagccaccttctgccttgca
cactgtgcctgcctggagcgcctgcacagccctctcgagcagcagccctccaccccgggc
tgtgggtgcagagctccaggggccgttcccgtggtcaagcgtgagcccctggactcacct
ctgtgggccgctcccagccaagtaggggtgcccagagtattccccagaagtgccttggcg
atcccgcccgaagcctcggaatgcacgtccctgctgtga

DBGET integrated database retrieval system