KEGG   Turicibacter sp. H121: AT726_06690Help
Entry
AT726_06690       CDS       T04254                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tur  Turicibacter sp. H121
Pathway
tur03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tur00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AT726_06690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tur03011]
    AT726_06690
Ribosome [BR:tur03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AT726_06690
  Bacteria
    AT726_06690
  Archaea
    AT726_06690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TINF2_N
Motif
Other DBs
NCBI-ProteinID: AMC08622
UniProt: A0A0X1TKN9
Position
1401383..1401718
Genome map
AA seq 111 aa AA seqDB search
MEAKAMARTVRIAPRKARLVIDLIRGKQVGEAYAILKHTPKAASPIVEKVLKSAIANAEH
NLNLDINSLYVKEAYVNEGTTLKRFRPRAQGRASQINKRTSHITIVVAEKK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaagctatggctagaacagttcgcattgctcctcgtaaagcacgcttagtg
attgacttaattcgaggaaaacaagtaggcgaagcatacgcaattttaaaacacactcct
aaagcggcatctccgattgttgagaaagttttaaaatcagctatcgcaaatgctgaacac
aacttaaacttagatatcaattcactatatgttaaggaagcatatgtgaatgaaggtaca
acattaaaacgattccgtccacgtgcacaaggtcgtgcatcacaaatcaacaaaagaaca
tctcacatcactatcgtggtagctgagaaaaaataa

DBGET integrated database retrieval system