KEGG   Turicibacter sp. H121: AT726_09770Help
Entry
AT726_09770       CDS       T04254                                 

Definition
(GenBank) glycine--tRNA ligase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
tur  Turicibacter sp. H121
Pathway
tur00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tur00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AT726_09770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tur01007]
    AT726_09770
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tur03016]
    AT726_09770
   03029 Mitochondrial biogenesis [BR:tur03029]
    AT726_09770
Enzymes [BR:tur01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     AT726_09770
Amino acid related enzymes [BR:tur01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   AT726_09770
Transfer RNA biogenesis [BR:tur03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AT726_09770
Mitochondrial biogenesis [BR:tur03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AT726_09770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: AMC09160
UniProt: A0A120IDP9
Position
2053324..2054697
Genome map
AA seq 457 aa AA seqDB search
MSQVTMEKIVNMCKTQGFVYQGSEIYGGLANTWDYGPLGVELKNNVKKAWWKKFIQESPY
NVGLDSAILMNPQTWVASGHVGGFSDPLMDCKACKSRHRADKLIEDHGDDIVADGWTEEQ
MMAYIREHNIACPDCGAHDFTDIRQFELMFKTHMGVVSDDKSAVYLRPETAQGIFVNFKN
VQRTSRKKIPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDGQWYEFWKQY
CWNWLVNLGMNPEHIRQREHSPEELSHYSNGTSDIEYRFPFGWGELWGVANRTDFDLKAH
MKESGANFEYQDPTTNEKYVPYCIEPSVGADRVTLAFLIDAYEEETLENGETREVLKFHP
ALAPYKVAVLPLVKKLNEQSLEVFAELSKHMMVDYDEAGTIGKRYRRQDAIGTPFCVTFD
YDSLEDKKVTVRHRDTMEQERVAIDELVEYITSKIQF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtaacaatggaaaaaatcgtaaatatgtgtaaaacacaaggattcgtttac
caaggaagcgaaatttatggaggattagcaaatacttgggattatgggccgttaggtgtg
gaattaaaaaataacgtgaaaaaagcttggtggaaaaaatttatccaagagtcaccatat
aatgtggggttagatagtgccatcttaatgaatcctcaaacttgggttgcatcagggcac
gttggaggatttagtgatcctttaatggactgtaaagcatgtaagagtcgtcaccgtgca
gataaattaatcgaagatcatggagacgatatcgtagctgatggatggacagaagaacaa
atgatggcttatattcgtgagcacaatattgcatgtccagactgtggagctcatgatttt
acagatattcgtcaatttgaattaatgtttaaaacacacatgggagttgtttcagacgat
aaatcagctgtttatttacgtccagaaacagcacaaggaatcttcgttaatttcaaaaat
gttcaacgtactagccgtaaaaaaattccatttggaattggacaaatcgggaaatcattc
cgtaacgaaattacaccaggaaactttacattccgtacacgtgaattcgaacaaatggaa
ttagaattcttctgtaaaccaggtgaagatggacaatggtatgagttctggaaacaatat
tgctggaattggttagtaaatttaggaatgaatccagaacatattcgtcaacgtgaacat
tcaccagaagaattaagtcactacagtaacggaacatcagatatcgagtaccgtttccca
tttggttggggagagttatggggagttgctaaccgtactgacttcgacttaaaagcacat
atgaaagaatcaggagcaaacttcgaatatcaagatccaacaacaaatgaaaaatatgta
ccatactgtattgaaccatcagtaggagcagaccgtgtgacattagcgttcttaattgat
gcttatgaagaagaaacgttagaaaatggagaaacacgtgaagttttaaaattccaccca
gctttagctccttacaaagtggcggtcttaccattagttaagaaattgaatgaacaatca
ttggaagtgtttgcagaattatctaaacatatgatggttgattatgatgaagcgggaaca
atcggtaaacgttatcgtcgtcaagatgcaattggaacaccattctgtgtcacattcgac
tatgattcattagaagataaaaaagtaacagttcgtcatcgtgatacaatggaacaagaa
cgtgtagcaatcgatgaattagttgagtacattacttcaaaaattcaattttaa

DBGET integrated database retrieval system