KEGG   Tetranychus urticae (two-spotted spider mite): 107360638Help
Entry
107360638         CDS       T04901                                 

Definition
(RefSeq) alkaline phosphatase isoform X1
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00730  Thiamine metabolism
tut00790  Folate biosynthesis
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    107360638
   00790 Folate biosynthesis
    107360638
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tut04147]
    107360638
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tut00537]
    107360638
Enzymes [BR:tut01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     107360638
Exosome [BR:tut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107360638
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tut00537]
 Enzymes
  107360638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase JHBP
Motif
Other DBs
NCBI-GeneID: 107360638
NCBI-ProteinID: XP_015782819
Position
Unknown
AA seq 796 aa AA seqDB search
MFHPIIWLLLSIVAPFGLAHGTPLTTLTSLSSSSSNSIDLTNVFDKCLSIHEQVTLSSQI
QLSPLLSCDRDLFKVVLDNTRITGLNKYLITPFKRVNKDKYEATMSIEGIKVESNYHING
PVAHMFPVSGEGTLEMDYVNITIDLGVKKSSESDNLVNIYAEKIDFHNHGYEVINGKQTV
DNKADHLDKGFQESLGKVIFWQIFKALKVDPSFNVSVKCLEDSIQSDQLLNTLSYNDLPR
NNVHHASEIVAMKSHHSSVYSVESHSRAKRDVSPQLPNIPEIETTEAHWYKKAQESLDAT
MNIKKLNKNAKNVILFIGDGMGISTLSAARVLKEQLNGLPGGSNRLFFEEFPQSALIKTF
NLDRQTPDSAGTATAFTCGIKANYATLGVSGRIFKSEKDCSVIAANAVPSIFTWAQAAGK
GTGIVTTTRITHATPAAGYAHVSNRDWESDTDVAKFGASCKDIARQLVEDAPGNKLNVIM
GGGWKHFAGSNVSDPTPSAGAAGGRTDGVNLIDRWISDREARSANWSFVTSTKDLRSVDT
AKTDYLFGLFNRDHLPYELERNKSPEGSPSLAEMVESAVNVLSKHDNGFVLLVEGGLVDI
AHHDNYARLSLHEVLGLEAAIQKATELLPLDETLIIVTADHSHGFVMNGYPLRGNDIFGV
SDTKEDGVNKTFSTLMYTTGPGHVEPRPDEAKVTSRDNPRYRFYSAINLSSAVHGGEDVA
LYSVGPMSHLFNGLQDQSYIAHVIAYSSCIGEYASTERCKNQLKSAAPGNKNNLSILVYF
ILTVLLFVYNSRLSML
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatccaattatttggttgctgctctcaattgtggctccttttggcttggcccat
ggaacaccgctaaccactttaacttcattatcatcttcatcaagtaactccattgatttg
accaatgtttttgacaaatgtttaagtatacatgaacaagtcacattatcttctcaaata
caattgtcacctcttttatcgtgtgatcgagatctctttaaagttgtactcgacaacacc
agaatcacgggtctcaacaaatatctgataaccccattcaaaagggtcaacaaagataaa
tatgaagcaactatgagcatcgaaggaataaaagttgaatcaaattaccatattaatgga
cccgttgcccacatgtttccagttagtggggaaggtacactagagatggattatgttaac
attacaattgacttgggtgtcaagaaatcatctgaatcagacaacttagtaaacatttat
gctgaaaagatagattttcataatcatggctacgaggtaatcaatggtaaacaaacagtg
gacaataaagctgatcatttggataaaggtttccaagagtcgctgggcaaagtcattttt
tggcaaatctttaaagctctaaaggtggacccatctttcaatgtatcagtaaaatgtctc
gaggattcaatacaatcagatcaattgttgaatacgctgagttacaatgatttgcctaga
aataatgtccatcatgcctctgaaatagttgccatgaaatcccaccattcctcagtttac
tcagttgaaagccattcaagagctaaaagagacgtctctcctcagttacctaacattcca
gaaattgaaaccacagaagcacattggtataaaaaagctcaagaatctttagacgcaacc
atgaatatcaagaaattaaacaaaaatgccaaaaatgttattctattcattggtgatgga
atgggaatttcaacactttctgctgcacgagttttgaaagaacaattaaatggattacct
ggtggatctaatagattatttttcgaagaattccctcaatcagctttaatcaagactttc
aaccttgacagacaaacacccgattcagctggtacagcaacagcattcacctgtgggatc
aaggctaattatgcaactcttggtgtatccggaagaatattcaaaagcgaaaaagattgc
tctgttattgcagccaacgcagttccatctattttcacttgggcacaagctgcaggtaaa
ggaactggaattgtaactacaactcgaatcacacacgccactccagcggctggctatgct
catgtttctaatcgtgactgggaaagtgacactgatgttgctaagtttggagccagttgt
aaagatattgctcgtcaattggttgaagatgctccaggtaacaagctgaatgtaatcatg
ggaggaggatggaaacactttgctggttcaaatgtatctgatcccactccttcagctgga
gctgcaggcggtcgaaccgatggtgttaaccttattgatcgctggatttctgatagagaa
gctcgttcggcgaactggtcctttgttacttcaaccaaagaccttagatcagttgatact
gcaaaaactgattacttatttggtcttttcaatcgtgatcatttaccatatgagttagaa
cgtaataaatcaccagaaggctcaccaagcttagctgaaatggttgaatcagctgtcaat
gttttatccaaacatgacaatggatttgtgttgcttgttgaaggtggtcttgtggatatt
gctcaccatgataattatgctcgactttcacttcatgaagtattaggtttggaagctgct
attcaaaaagcaactgaacttcttcctttagatgaaaccttaatcattgtaaccgctgac
cattctcatggatttgtcatgaatggttatccattgcgtggtaatgacatttttggagtc
tctgataccaaagaggatggagttaataaaaccttttcaacccttatgtacaccactgga
cctggtcatgttgagcctcggcctgatgaggctaaagttacaagcagagataacccacga
tatcgattctattctgccatcaatttgtcctcagctgttcatggaggtgaagatgttgcc
ttgtacagtgttggaccaatgtcacatttattcaatggacttcaagatcaatcatatatt
gctcatgtaattgcctattcatcctgtattggtgaatatgcctctaccgaaaggtgcaaa
aatcaattgaaaagtgcagctccaggtaacaaaaacaatttatcaattctagtgtatttt
atattaactgtcttattatttgtttacaactcacgtctttcaatgctgtaa

DBGET integrated database retrieval system