KEGG   Tetranychus urticae (two-spotted spider mite): 107361220Help
Entry
107361220         CDS       T04901                                 

Definition
(RefSeq) nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:tut00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    107361220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tut03009]
    107361220
Ribosome biogenesis [BR:tut03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    107361220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT Ribosomal_L12_N VirArc_Nuclease
Motif
Other DBs
NCBI-GeneID: 107361220
NCBI-ProteinID: XP_015783479
UniProt: T1K7X6
Position
Unknown
AA seq 541 aa AA seqDB search
MLILFESAVGYAVFKLKDDKKLEKVDKLHALFEDPASANKLLNLQAFEKFSDVTEAVECA
TSMLEGKASKKLKKLLKKIVAKEPNEIVGVADPKLATYIKEKFNVSSAATSAVQQLMSCI
RLNVENLIPEWSPSENEAMEMGLSHGISRYQLKFSADKVDTMIIQAVSLLDNLDKELNNY
IMRCKEWYGWHFPELAKVVPDNTSYIKAVLKMGIRTNAYSCDFSEFLAPETEQEIKELAE
VSMGTDISEEDMMNIEHLCRNVLDMQEYRTQLFEYLKNRMMAIAPNLTMLVGELVGARLI
THAGSLINLAKHPASTIQILGAEKALFRALKTRHDTPKYGLIYHAQLVGQSNPRLKGKMS
RMLAAKSALACRVDAMGENPGNALGLEHKAKLEARLKVLEESKVRAISGTGKAQAKWDKY
ENKSQMLSYKSGGDSTMPQSGKRKHEKDDVQPKASASGNFFGQKVQLKTEKDDDDDEDSD
DDDEESDSSEEEAKQPPMFSASKSSAKKGKPEPARISKPAPQAAADSSSSEESDDSSDDS
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttgattctttttgaatctgctgttggttatgctgttttcaagctcaaagatgataaa
aaattggagaaagttgataagctccatgctttatttgaagatcctgccagtgccaataaa
ttactaaatttacaagcatttgaaaaattttcagatgtgactgaagctgttgaatgtgct
acatcaatgttggaaggaaaagcaagcaaaaagttgaaaaaattgttgaaaaaaatcgtt
gctaaagagccaaatgaaattgttggtgttgctgaccctaaattggcgacttacattaaa
gaaaaatttaatgttagctctgccgctacatcggctgtgcaacaattaatgtcctgcata
agattgaatgttgaaaatttgataccagaatggtcaccatcagaaaatgaagccatggaa
atgggattaagtcatggtatttcaagatatcaactcaaatttagtgctgataaagtggat
acaatgattatccaagctgtttctctactggacaatttagataaagagctaaataattat
attatgagatgcaaagaatggtatggttggcattttcctgaattggctaaagttgttcct
gacaatacgtcttatattaaagctgttttgaaaatgggaatccgaacaaatgcatattca
tgcgacttcagtgaatttttggccccagagacggagcaagaaattaaagaattagcggaa
gtttcaatgggtactgatatttcagaagaagacatgatgaatatcgaacatttatgtaga
aatgttttggatatgcaagaatatcgtactcaactgtttgaatatttaaaaaatcgaatg
atggcaatcgcacccaatctaactatgttggttggagaattggttggcgctcgcctaatt
acccatgctggctctttgataaacttagcaaaacatcctgcttcaactatccaaatatta
ggtgctgaaaaagccctatttcgtgctcttaaaacacgccatgacactcccaagtatggt
ttgatttatcatgctcagttagttggccaaagtaatccacggcttaaaggtaaaatgtct
cgaatgcttgctgctaaatcagctctagcctgtcgtgttgatgcaatgggtgaaaatcca
ggaaatgctttaggattagaacataaagcaaaattagaggcgagattaaaagttttagaa
gaaagcaaagtcagagctatcagtggaactggtaaagctcaagcaaaatgggataaatat
gagaataaatcccaaatgctatcttataagtcaggaggagattcaacgatgccgcaaagt
gggaaaagaaagcacgagaaagacgatgttcaacccaaagcatcagcttcaggtaatttc
ttcggacaaaaagtgcagcttaaaacagaaaaggatgatgacgacgacgaggatagtgat
gacgatgatgaagaatctgactcgtctgaagaagaagcgaagcaacctccaatgttttct
gctagcaaatcatctgctaaaaaaggcaaacctgaaccagctcggatctctaagcctgca
ccccaagctgctgctgactcttctagtagtgaagaaagtgatgatagcagtgatgacagc
gattaa

DBGET integrated database retrieval system