KEGG   Tetranychus urticae (two-spotted spider mite): 107362309Help
Entry
107362309         CDS       T04901                                 

Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00480  Glutathione metabolism
tut00590  Arachidonic acid metabolism
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107362309
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107362309
Enzymes [BR:tut01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107362309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 107362309
NCBI-ProteinID: XP_015784829
UniProt: T1KB46
Position
Unknown
AA seq 175 aa AA seqDB search
MAEENKSVDPKNASSIFDFTVKNLDGEDVPLDKYRGKVCLVVNVASNCGLTKNNYKQLNE
LYAKHKDSGNFAILAFPCNQFAGQEPACETDLKEYVVKQKIEFDFFGKVNVNGKQAIPLY
DYLKSKQGGMLGDFIKWNFTKFLCNKEGVPVKRYSPTTEPNQIEKDIVGLLEEKN
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagaaaataaatccgttgaccctaaaaatgccagttcaatttttgattttacc
gtgaaaaatctcgatggagaagacgttcctctagataaatacagaggcaaagtctgtttg
gttgttaatgttgcgtccaattgtggtctcaccaagaacaattacaaacagttaaatgag
ctctatgcaaaacacaaggattccggaaatttcgccatcctcgctttcccctgtaaccaa
tttgcaggtcaagaaccagcatgtgaaacggatctcaaggaatatgttgtcaaacagaaa
attgaatttgacttttttggtaaagttaatgtaaacggaaaacaagccattccactttac
gattacttgaaaagcaaacaaggaggaatgttgggtgatttcatcaaatggaatttcacc
aagttcctttgcaataaagaaggtgttcctgtcaaacgatattctccaaccactgaacca
aatcaaattgaaaaagatatcgttggcctcttggaagaaaagaactaa

DBGET integrated database retrieval system