KEGG   Tetranychus urticae (two-spotted spider mite): 107363099Help
Entry
107363099         CDS       T04901                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00071  Fatty acid degradation
tut01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107363099
Enzymes [BR:tut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     107363099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 107363099
NCBI-ProteinID: XP_015785756
UniProt: T1KEH0
Position
Unknown
AA seq 651 aa AA seqDB search
MALQINLLKGRPFNMNFSRSLKSWSTNNADEYNNLMKSNIPTDYYQASLPQLPIPRLDLS
CQRYLNALRPIISNDEQFTKTLNIVGSFKIGIGQQLQNHLCEKNRALRHTSYIADDWMDS
YLSSRLSLPLNFNPFLILRNDPVTEYNQPCIKAANHLISCLRYRRSFIENRLEPDVKKSK
DKEIPYDMSQHQNLFGSTRIPALNLDFLQTYPDSKHVIVMKRGRFYYFNALDDSGNLKTP
NYIYSCLKYIWDKPDEPGNCHKISWLPCLPRDDWARARTHLLENPSNVANFALIDSALTF
ICFDVDVDFDDITNPKKQREAYGHNALHGNLSSEQFANLQQFPLNRWFDKSFSTIFTKNG
ASAINFEHSWVDGATMSRFYDRIYADSTKNHFVSPGDNFDRKVCGEVKEVTFKIDEGFKP
HIEAAKRAHENQTNKLELNYIQDCRLNSSYLKSKKLSTDSIFHLAFQMAFFKISSGQTPA
TYESCSTAHFKHGRTETIRAATSSTQKACKMFHVSREKYVLNDLRSAINESSQTHSALVK
EASLGQGFDRHWFALKKIAEKQGMNDVSIFKDQSYQIANHFILSTSLLFAGNITGGGYGP
AVSDGFGLAYGYDDKDLGVFCSNWKDTRNGVEFAQAVEESFKDIHSILEST
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggctctccagatcaatttgctgaaaggtcggcctttcaatatgaatttttctcgatct
ttaaagtcttggtccaccaataatgctgatgaatataataatttgatgaaaagtaacatt
ccaaccgactattatcaagcaagtttgccgcaattgcctataccgagattagatttatcc
tgccaacgttacttgaatgcgttgcgaccaataatttctaatgatgaacaatttaccaaa
actctgaacattgttggtagcttcaaaattggcattggtcaacagttacaaaatcatctt
tgtgaaaaaaatcgagctcttcggcacacaagttacattgctgatgattggatggactca
tatttatcttcaagattgtctcttcctctgaacttcaatccttttctgattcttcgaaat
gaccctgtgactgagtacaatcaaccttgcatcaaagcggcaaatcatctaatcagctgt
cttcgatatagacgatcatttatcgagaatcgattggagcctgacgttaaaaaatcgaag
gataaggaaataccatatgacatgagtcaacaccaaaatttatttggttcaactagaatt
ccagctctcaatctagacttcttgcaaacatatccagactctaaacatgttattgtaatg
aagagaggtcgcttttactatttcaatgctcttgatgatagtggtaatctcaaaactcca
aattatatttattcttgtcttaaatatatttgggataaaccagacgagcctggaaattgt
cataaaatctcatggttaccctgtttacctcgagatgattgggctcgagcacggacacat
ctgcttgaaaatcccagcaatgtagcaaactttgctctgattgattctgcattgacgttt
atctgtttcgatgttgatgttgattttgatgatattactaaccctaaaaaacaaagagaa
gcttatgggcacaatgctttacatggaaatctttcttctgaacaattcgcaaacctccaa
cagtttcctttaaatcggtggtttgacaagtcattttcgactatattcacaaaaaatgga
gcctctgcaattaattttgagcatagctgggttgatggtgcaacaatgagtcgtttttat
gacagaatctatgctgactctactaaaaatcattttgtttcgcctggagataattttgac
cgtaaagtttgtggcgaggttaaagaagttacatttaaaatcgacgaaggcttcaagcca
cacattgaagcagcaaaaagagcacatgaaaatcaaacgaataagctagaattgaattac
attcaagattgtcgattgaatagtagttacttaaaatcgaaaaaactaagtactgactct
atttttcatttagcttttcaaatggccttttttaaaatctcatcaggacaaactccggct
acatatgaatcttgttcaactgcacacttcaaacatgggaggacggaaacaattagagct
gcaacttcatctacacaaaaggcttgtaaaatgttccatgtttcaagggaaaagtacgtt
ttaaatgatttacgttcggccataaacgaatcatctcagactcattcagcactcgttaag
gaagcttctcttggacagggttttgatagacattggtttgctttgaagaaaatagctgaa
aaacaaggaatgaatgatgtttccattttcaaagaccaatcctaccaaatagccaatcat
tttattctctcaacttctctgctttttgctggcaacataactggtggtggatatgggcct
gctgtttctgatggcttcggtcttgcttatggctacgatgacaaagatttaggggtcttt
tgctctaattggaaagatacaagaaatggtgttgaatttgctcaagctgtggaagagtct
ttcaaagatattcatagtatcctcgagtcaacctga

DBGET integrated database retrieval system