KEGG   Tetranychus urticae (two-spotted spider mite): 107363705Help
Entry
107363705         CDS       T04901                                 

Definition
(RefSeq) guanylate cyclase soluble subunit alpha-1-like
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00230  Purine metabolism
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107363705
Enzymes [BR:tut01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107363705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA DUF2309
Motif
Other DBs
NCBI-GeneID: 107363705
NCBI-ProteinID: XP_015786460
Position
Unknown
AA seq 601 aa AA seqDB search
MIDSLNNMDYKEKLCDHISTESTSIVSPGLVNNARENVDNNGNCESELRKGEGNDKFSSE
MKTQVSEDSSVNSISNETKDLLITMKIFCKAFPFHFICDSNLQIVQLGEGLLRIFGGGNR
AYGTHISSYFSFQKPEINQVNYQSLVTLANIPFIIKVLDPEPEAKPKNLELKGQIITCPE
SFCLLFLGSPVVDGLESLTSRGLYLSDIPIHDATRDIILVEEQSRAQESLKRRMDKLRES
IQQANEAVAMERKKNVDLLNLIFPAQVAKKLWLSEQVEAQQYDDVTMLFSDIVGFTAICS
NATPMMVINMLNALYTQFDSFCGEIDVYKIETIGDAYCVAAGLHRPSDIHAQQAAWMALK
MINAVNTVLSPTGLPLQMRIGLHTGSVLAGIVGIKMPRYCLFGNNVSLANKFESQSEPMR
VNISPTTYRLLSSRPGFKFTERSRDCLPPGFPPEIPGNGYFVDDYKHSGVDAKESLAKHI
GQALIDNQLTFENIQLQTQEVINKIAETKGVAVENIMAIRVEDTVMECNKNLKATSSCSS
STSCGTNKANNNDNKVNSDSKENNKSDNKLDNSTIESNFDEMKSSMSRGKTSRTGCPMFF
K
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcattgaataatatggattacaaggaaaaactgtgcgatcatatttcaact
gaatcaacatcaattgtttcacctggtttggtcaacaatgcacgtgaaaatgtagacaat
aatggcaattgtgaaagtgaattacgaaaaggtgaaggaaacgataaattttcaagtgaa
atgaaaactcaagtttccgaagattcaagtgtaaacagcatatccaatgaaaccaaagac
cttctcataaccatgaaaatattttgcaaagcatttccatttcattttatctgtgattca
aatttacaaattgtccaattaggtgaaggtttacttcgaatatttggaggtggaaatcga
gcctatggaactcatatttcaagctattttagcttccaaaagcctgaaattaatcaagtc
aattatcaatctttggttacactggccaacataccatttatcattaaagttttagaccca
gaaccggaagcaaagccaaagaatcttgaacttaaaggtcagataataacttgtcccgag
tcgttttgtcttctttttttgggttcaccggttgttgatggactagagtctttgaccagt
cgaggtctctacttgtcagatattcccattcacgatgcaactcgagacattattttggtt
gaggaacagtctcgagctcaggagagtttaaagcgacgaatggataaacttcgggaatcg
attcagcaagccaatgaagctgttgccatggaaagaaagaaaaatgttgatctattgaat
ctcatttttcccgctcaagtggctaaaaagttgtggctttcagagcaggttgaggctcaa
cagtatgatgatgttacgatgctcttttccgatattgttgggttcactgccatatgttca
aatgcaactccaatgatggtcatcaacatgttaaatgctctttacactcaatttgacagt
ttttgcggtgaaattgatgtttacaagattgaaacgattggtgatgcgtactgtgtagct
gctggacttcatcgaccaagcgacattcatgctcagcaagctgcttggatggcacttaaa
atgattaatgcagttaacactgttttatcaccaactggattaccacttcagatgagaatt
ggtctgcacacaggatcagtcttggctggtatagttggaatcaaaatgcctcgatactgt
ttatttggaaacaatgtttcccttgcaaacaaatttgaatctcaaagtgaaccgatgaga
gtcaatataagtccaactacttacagacttttaagcagccgtcctggattcaagtttact
gagcgttctcgtgactgtcttccacctggatttcctcctgaaatacctggcaatggttat
tttgtggacgactataagcattcaggtgtcgatgcaaaagaatccttagcgaagcacatt
ggccaagctttgatcgataatcagttgacttttgaaaacattcaactgcaaactcaagag
gttattaataagattgcagagacgaaaggagttgccgttgaaaatataatggcgattcga
gttgaagatacagttatggaatgcaacaaaaatttgaaggcaacttcatcatgctcatca
tcaacatcttgtgggaccaataaagccaataataacgacaacaaggtcaacagtgattca
aaggaaaacaataaaagtgacaataaactggacaattcaacaatcgaatcaaattttgat
gaaatgaaaagttcaatgtcgagagggaaaacatcgcgaactggttgtccaatgtttttc
aagtga

DBGET integrated database retrieval system