KEGG   Tetranychus urticae (two-spotted spider mite): 107364113Help
Entry
107364113         CDS       T04901                                 

Definition
(RefSeq) septin-7 isoform X1
  KO
K16944  septin 7
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Brite
KEGG Orthology (KO) [BR:tut00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tut04131]
    107364113
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tut04812]
    107364113
   04147 Exosome [BR:tut04147]
    107364113
Membrane trafficking [BR:tut04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    107364113
Cytoskeleton proteins [BR:tut04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     107364113
Exosome [BR:tut04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107364113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 AIG1 Ras RsgA_GTPase FeoB_N Gtr1_RagA Roc P4Ha_N DUF5401
Motif
Other DBs
NCBI-GeneID: 107364113
NCBI-ProteinID: XP_015786912
Position
Unknown
AA seq 708 aa AA seqDB search
MVAGWEQQLSNNLANRNSSTLLTPTSPYPENGSLINPPPYPSVSNTPSSTNTASLLSSPT
SAVTSTPGKAGSGGILPNSASSGGLKSAREAFFADPSQSLSDTTKTNIIDTPQSPQLTSS
TLVSPLTTSKPSPRFASVDRLSGRQKIYDQTSELKSPSPEPCVVEDGEALNSKRDLYSTR
DISQSSVNSSTDSLLNSTSALSSSTRNALSGSKTDLMYSRSRNLYRDTLDSAETRRSMLS
SATPQDKLMVAKDSERNVGFSDLPNQIHRKTIKKGFEFTLMVVGESELGKSTLVNSMFLT
DIYSDEYPGPSKRLSKTVDVQATKVNLKEKNVNLSLTIVDTPGFGDSLDNTNSWQKISEY
IEDRYEEYLNAETKLHRTHIPDNRVHCCLYFILPRVTLRAIDIEFMKNLQDKVNIIPIIA
KADTLTEEECQQMKKNVMNQIAQHKIRIYEFPDCDDEDDAKLLKQLKARIPFAVVGSNQV
VDTPSGERKRARKYPWGTIEIDNLEHCDFIALRMMLIKYFMLDLVDTTNNVHYENYRCRK
LSGVGTEKSSKDNNINPLAQMEEERKASEAKLRRLEQEMDHVFETKVKAKEQKLEEMEAE
ILRFDEQNRKVHEKEVQELADKRAAFEKERDAFEVIAREMEEMRKNTLEANIRERPSKLS
NFRKLFSGKPCKRSSSPKSCSKLKSMVKLQTPSSPSNLNKKQRYLTLE
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggttgccggttgggaacagcaattgagcaacaatttagcaaatcgaaatagtagtaca
ctattgacacctacctctccatatcctgagaacggttccctaattaatcctcctccttat
ccttctgtttctaacactccctcctctactaatacggcttctttgttatcatcaccaaca
tcagcagttacatcaacccctggcaaggctggttctggtggtattttacctaactcagca
tcctccggtggattaaaatcagctcgagaagcattttttgctgatcccagtcaatcatta
tctgataccactaaaacaaatattattgatactcctcaatctccacaactaacatcgtcc
accctggtttctcctctcactacaagtaaaccatctcctcggtttgctagcgttgataga
ctttcagggagacagaaaatttacgatcaaacgtccgaactgaaatctccatcacctgaa
ccttgtgttgttgaagatggtgaagcactcaactcgaaacgggacctatattcaacacga
gatatttcacaaagttcagttaattcatctacagattcattgttaaattcaacttcagcg
ctttcatcttctactcgcaatgctcttagtggtagcaaaacggatttaatgtattcccgc
tcaagaaatctttaccgtgacactctcgactcagcagaaaccagaagatcaatgctttct
tcagctacccctcaagataagttaatggtggccaaagattcggaaagaaatgttggcttt
agtgaccttccaaatcaaattcaccgtaaaaccatcaaaaaaggatttgaatttaccctc
atggtcgtaggagaatcagaattggggaaatcaacactggtcaattcaatgtttttgact
gatatttattcagatgaatatcctggaccatccaaaaggcttagtaaaaccgttgatgtt
caggcaaccaaagtaaacttgaaagaaaaaaatgttaatttatcattaaccattgtggat
actcctggtttcggtgattcacttgataatactaattcatggcagaaaattagtgaatat
attgaagatcgatatgaagaatatctgaacgcagaaacaaagctccaccgaacccatatt
cctgataatcgtgtgcattgctgtttgtatttcatattacctcgtgtaactttaagagca
attgatatagagtttatgaaaaatttacaagataaagtcaacatcataccaataattgcc
aaagctgataccttaacagaggaagaatgccaacaaatgaagaaaaatgtcatgaatcaa
atagcacaacacaaaatcagaatttatgaatttcccgactgtgatgacgaagatgatgct
aaattattaaaacagctcaaagctcggattccattcgcagttgtcggcagtaatcaagtt
gtagatacaccaagtggcgaaagaaagcgagcaagaaagtatccttggggaacaattgaa
attgacaacctggaacattgtgatttcattgctcttcgtatgatgcttatcaagtatttc
atgctcgacttggttgatacaacaaataatgttcattatgaaaattatcggtgccgaaag
ttatctggcgttggaactgaaaaatcttcaaaagacaataatataaatcctttggctcaa
atggaagaagaacgtaaagcctcagaagccaaattgagaagacttgaacaggaaatggat
catgttttcgaaaccaaagttaaggccaaagaacaaaaactcgaagaaatggaagcagaa
atacttcgttttgacgagcaaaatcgtaaagttcatgaaaaagaggtacaagaattggct
gataaaagagctgcttttgaaaaggaaagagacgcttttgaagtaattgcacgagaaatg
gaagagatgagaaagaatactttggaagcaaatattagagagcgaccaagcaaattatct
aatttccggaagctgttttctggtaaaccctgtaaacggtcctcctcacccaaaagttgc
tctaaattgaaatcaatggttaaactacaaactccttcgagcccatccaatctcaacaag
aaacaacgttatcttacactggaataa

DBGET integrated database retrieval system