KEGG   Tetranychus urticae (two-spotted spider mite): 107364454Help
Entry
107364454         CDS       T04901                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1-like
Organism
tut  Tetranychus urticae (two-spotted spider mite)
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 107364454
NCBI-ProteinID: XP_015787286
Position
Unknown
AA seq 533 aa AA seqDB search
MASTTGTLKNISGVLVAMHKGVRVAVKVVPVKKFSINRALLMELKQMRETLHENLSRFVG
LCTEEPNRAIITELCLRGSLRDLLENEAIQLDWVFKYAMITDIAEGMGYLHSSPIQFHGN
LNSSNCIINERFTVKITDYGIREFRKQIDRMEDFNPRKFFWKAPEHLRERDPFNTGSQKG
DVYSYAIILQEIITRSGPFESMERLGRKRAHMEPDEILDRIRMGMVPPFRPEVSADEAPR
ELIRLMHAAWHENPDSRPDFATIKPILKRITKGTSSRNLFDNLLSRMEQYTNNLERMVEE
KTESLMEEKKKTEELLYQLLPQFVAEELKKGSQVYPEAFDAVTIFFSDIVGFTNISAEST
PLQVVDLLNYLYTTFDNVIEKYDCYKVETIGDAYMVASGLPIRNGNDHVREICRMALELR
NSMRNAKVPHDPEKTLMVRIGIHSGPCAAGVVGLKMPKYCLFGDTVNTASRMESHGEPLK
IHISKATRDIIEQFFRSFIIVPRGEIEIKGKGIMKTYWLEGEVIDANQKTTGR
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtacaacgggaacattgaaaaatatttctggagtgttggttgcaatgcacaaa
ggagtccgagttgcagttaaagtggttcctgtcaaaaaattttccataaacagagcctta
ctcatggaactgaaacaaatgagagaaacacttcacgagaatctaagtcgatttgttgga
ttgtgtactgaagaacccaatagagccataataacggaattatgtttacgaggtagcttg
cgagatttacttgaaaatgaggccatacaattagattgggtctttaaatatgccatgatt
actgacattgctgaaggaatgggttaccttcactcttcaccgatacagtttcatggtaac
ctcaactcctccaattgtatcatcaatgaaaggttcaccgtgaaaataacagattatggt
atcagagagtttcgtaagcagatagatcgtatggaagattttaatccacggaaatttttc
tggaaagctcctgagcatttacgtgaacgagatccattcaatactggttcccagaagggt
gatgtttactcgtacgcaatcattttacaggaaataatcactcgatcaggtccttttgag
tcaatggagaggcttgggcgtaaacgagcacacatggaaccagacgagattttagataga
atcaggatgggcatggttccaccctttcgccctgaagtgtcagccgatgaggcaccaaga
gagttgattagattgatgcatgcagcttggcacgaaaatcctgatagcaggcctgacttt
gccacaataaagcctatactcaaacgcattaccaaaggaacctcgtcacgaaatttgttt
gacaatctgctcagtcgtatggaacaatacacaaataacttggaacgtatggttgaagag
aagacggaatcgctgatggaagagaagaaaaagactgaagaactgttgtaccaattatta
ccacaatttgtagcagaagagttgaagaagggtagccaggtttatccagaagcatttgac
gctgttaccatatttttctcggacattgttggctttaccaatatatcagctgaaagcaca
ccacttcaagtagtcgatttacttaattatttatacactacatttgataatgtaattgaa
aaatatgattgttacaaggttgagacaattggcgatgcttatatggttgcatctggttta
ccaataagaaatggcaatgatcatgttagagaaatatgtcgaatggctttggaattgaga
aactcaatgcgtaatgctaaagttccacatgatcctgaaaagactctaatggttcgtatt
ggtatccattctggtccatgtgctgccggcgttgtaggccttaagatgcctaaatattgc
ctttttggtgatacagttaacactgcgtcaagaatggaatctcatggagaacctcttaaa
attcacatttcaaaagctacaagagatatcattgaacaatttttcagatcttttataatt
gttccaagaggagaaattgaaatcaagggcaaagggataatgaagacttattggttggaa
ggagaggtcatagatgcaaatcagaagaccacaggaagatga

DBGET integrated database retrieval system