KEGG   Tetranychus urticae (two-spotted spider mite): 107366037Help
Entry
107366037         CDS       T04901                                 

Definition
(RefSeq) putative glucosylceramidase 4
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00511  Other glycan degradation
tut00600  Sphingolipid metabolism
tut01100  Metabolic pathways
tut04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107366037
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107366037
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107366037
Enzymes [BR:tut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107366037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C DDE_3 HTH_10 Sigma70_r4_2
Motif
Other DBs
NCBI-GeneID: 107366037
NCBI-ProteinID: XP_025017470
Position
Unknown
AA seq 897 aa AA seqDB search
MDRLLPCTIVLLLFINTVKTDGCHKRKFKEDSFVCVCNELECDSFEPVTNPPKGLIYSYV
SDRDEHRFHKDTLDPKTLVNTVTADSIKLSINVNETYQQIIGFGGAFTDAAGININVCKV
KMEMIFELDYLKMAISAPELKMLKLKQNEVFKICANIYEKFEDKSARSEIIAKFIAAGVP
TTTAYRQYAKLSIGNNGRKPGSGLSASKFNNSNVKKIEKMVVDKVFCGYAAVARAIGVSK
PTAKSYIERAEIKIAKRKKVPKVSPEQKQRQKTRIRRLRMEIGDQELILDDESYFDLEGF
NFYGSDRCAFKALENCPDDVRYRQQSKFGPKLMVWIAIGTKGFCKPYFHLTKGALNADLY
AKECLRKRLIPWLKSTYKNKKILFWPDLASCHYARTSLETLEGASVNYVKKDDNPPNCPQ
LRPIEDFWANLKCKVYSDGWLPKCKKDLINRIRNVLRKYDPIYFTNLIENVKSKVIKADQ
FENHFHFYFTYVKSLPDKLVLDLIRDYFGKDGLEYNMGRVTIGGADFSTRPYTYQDDYQD
LNWTHFALVEEDLVYKIPYIKLANDFSGGLKLFGSMWSPPAWMKYQQRINGTGILIGDPG
EAYYKPMASYMVKFLDEYKKHGVEFWGITTLNEPSAGFKPDYPFNCLGISPEQMTKWIAK
DLGPILKAAGYGKDKLKLLILDDNVSLLFLYASRVFSNYEASQYVSGIAVHWYENKLFGF
DQFDKTHQFFPDYFMLSTEACTGLGYDGIAVKLGLWSRGEEYANDLVGNMNHWSSGWVDW
NLALDMIGGPNWVSMFVDSPIIVNAEKQEYYKQPMYYALAHFSKFLKPGSTRLGFKVTNP
NDNVRSTVFKTEENQLVVITVNSNDYAVNLTIEGFAENVVGLTLGSHSFRTLVINKS
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggatagattacttccatgtacaatagttttgttacttttcatcaatacagttaaaact
gatggttgccataaaagaaaattcaaagaagattctttcgtttgtgtttgcaatgaactt
gaatgtgattcatttgaaccagtgactaatccaccaaaagggttaatttactcttatgta
tctgatagagatgagcatcgattccataaagatacattagatcctaagacgcttgttaat
acagttacagctgattccattaaactatccataaatgttaacgaaacttatcaacaaatt
attggttttggtggtgcttttaccgatgctgctggaattaacattaacgtatgtaaagta
aaaatggaaatgatttttgaattggattatcttaagatggcaatatctgcaccagaactc
aagatgttgaagttgaagcaaaatgaagtttttaaaatttgtgcgaacatctatgaaaag
tttgaagacaaatcagcgcgaagtgaaattatcgctaaatttattgctgctggtgtacca
actaccactgcatatcgtcaatatgctaagttaagtattggaaacaatggtaggaaacca
ggatcaggattatcagcctctaaattcaacaattcgaatgtgaaaaaaatcgaaaaaatg
gttgtcgataaagttttctgtggttatgcagctgttgcaagagctatcggagtgagcaaa
ccaacagctaaaagttatatcgaacgagctgaaatcaaaattgctaaaagaaaaaaagtg
cctaaagtttctccagaacaaaagcaacgacaaaaaacgcgaattcgtcgattgaggatg
gagattggtgatcaagaattgattttggacgatgagagttacttcgatttggaaggcttc
aatttctatggttctgatcgttgtgcattcaaggcattggaaaactgtcctgatgatgtt
aggtatcgtcaacaatcgaaatttggccctaagttaatggtttggattgcaattggtact
aagggattttgcaaaccttattttcatcttacaaagggtgcattgaacgcagatttatat
gcaaaagagtgtctacgaaagcgactcatcccttggctcaaaagcacttataaaaacaaa
aaaatactcttttggcctgatctagcgagctgtcactacgctcgaacatcgctcgaaacg
ctagagggcgccagtgtcaactatgtaaaaaaggatgacaacccacctaattgtccacaa
ttaaggcccattgaagatttttgggcaaatcttaaatgcaaagtctattcagatggttgg
ttgccgaaatgcaaaaaggatttaattaataggatcagaaatgttctcagaaaatacgat
ccaatttacttcactaatttaattgaaaatgttaaatccaaagtgattaaagctgaccag
tttgaaaatcatttccatttttactttacatacgttaaatcacttccagataaattagtc
ttggacctgattcgagattattttggtaaagatggattggagtataacatgggtcgagta
acaattggtggagctgatttttcaactcgtccttacacttatcaagatgattaccaagat
ttgaactggactcattttgcactggttgaggaggatttagtatacaagattccttatatt
aaactagcaaatgatttttctggaggcttgaaattatttggcagtatgtggtcacctcca
gcttggatgaaatatcaacaaaggataaatggtacaggaatcttgattggtgatccagga
gaagcttattacaaaccaatggccagttatatggtaaaatttctagacgaatataagaaa
catggagttgagttttggggaataactactttgaacgaaccaagtgctggttttaaacct
gattaccctttcaactgtcttggaatatctcctgaacaaatgactaaatggatagctaaa
gatcttggcccaatcctcaaagctgctggttatggcaaggataagcttaaattattgata
cttgatgacaatgtatcattgctatttctttatgcatcgagagtgtttagtaactacgaa
gcatcacaatatgtttctggtattgctgttcactggtatgagaataagctgtttggtttc
gaccaattcgacaaaactcatcaatttttccctgattatttcatgctatcgactgaagca
tgtactggtttgggctatgatggcatagcagtgaaattaggtttatggagcagaggtgaa
gaatatgcaaatgatttagttggaaatatgaatcattggagttcaggttgggttgattgg
aatcttgctcttgacatgattggtggacctaattgggtatctatgtttgtcgattccccg
ataattgtgaatgctgaaaaacaagaatattataagcaaccgatgtactatgcactggct
catttcagtaaatttttgaaaccaggatcaaccagattaggttttaaagttactaatcca
aatgacaatgttagatcaactgtatttaaaactgaagaaaatcaacttgttgttattacc
gttaacagtaatgattatgctgtcaacttgactattgaaggatttgccgaaaatgtcgtt
ggtttaactctcggatcccattcattccgaacactagtcattaacaaaagttga

DBGET integrated database retrieval system