KEGG   Tetranychus urticae (two-spotted spider mite): 107366726Help
Entry
107366726         CDS       T04901                                 

Definition
(RefSeq) enteropeptidase isoform X1
  KO
K01316  enterokinase [EC:3.4.21.9]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Brite
KEGG Orthology (KO) [BR:tut00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tut01002]
    107366726
Enzymes [BR:tut01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.9  enteropeptidase
     107366726
Peptidases and inhibitors [BR:tut01002]
 Serine peptidases
  Family S1: chymotrypsin family
   107366726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB Ldl_recept_a Trypsin_2 CUB_2
Motif
Other DBs
NCBI-GeneID: 107366726
NCBI-ProteinID: XP_015789836
Position
Unknown
AA seq 519 aa AA seqDB search
MFRSHVDYLHCQCESNDFNHQYNQFNETTKHCSSLDWFFESTFTISIMSQWSNLIWLLVL
SIFKSISTEPEGAIPTIDDLSACKPFQRPLIITKPYGYIVSPQYSDNGLYPYPEGSDCSW
TLVAPKNYVINMKMLTQDLDNWSDETRISFYDGQSVEDDLIDTFTGTKWRKFRTQSNQLH
IKFISGKRPSGVIPQYKGFKLYFEHNRAPVKCKEDQLRCANEEECIPKENICNGIDECRD
GTDEENCSDGHYNSTTSCGIRPNLITQQSEVFPYPFLMAIAAGDAAIPNSWPWMVSLRNR
RTEPSGHYCGGSLIGNQWVLTAAHCFLSDPDPKAYTIALGKHRSLIHDEKEITRYLIKII
SHPKFDRATKTGDLALVKLNAPISPVESWISPICLPNKMLKVEPGTMLTIIGWGDVQSTG
NPYVLKEGVIPLISNAICSEWLQNETPDSLMCAGYEEGGTDTCKGDSGGPIMMKLNDSWI
AVGVASYGLPCCGCVRQPGVYTRVEPHLDWIKETIEKNK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttcagatctcatgttgattatcttcattgccaatgtgaatcaaatgatttcaatcat
caatataatcaattcaacgaaaccaccaaacattgttccagtttggattggttcttcgag
tccacttttactatttcgatcatgtctcaatggtccaatttgatttggttgctagtccta
tcaatattcaagtccatttcaacggaaccagaaggtgccattccgacaatagatgacctt
tccgcgtgtaaaccatttcaaaggccacttatcatcaccaagccttatggttacattgtt
tcaccacaatatagtgacaatggactttatccatatcctgaaggatccgattgctcttgg
actttggtggctccaaaaaattatgtaattaacatgaaaatgctaacacaagatctggac
aattggagtgatgaaactcgaatttccttttatgatggacaatcggttgaggatgacttg
attgatactttcactggaaccaaatggagaaagtttaggactcagagtaatcaattgcac
attaaattcatcagtggcaaaaggcccagtggagtgattcctcaatataaaggtttcaaa
ttgtattttgaacataatcgagctccagtcaagtgtaaagaagatcaactaaggtgcgcc
aatgaagaagagtgcataccaaaagaaaatatatgcaatggaatcgatgaatgtcgagat
ggaactgacgaggaaaattgtagcgatggacattacaatagtactacttcatgtggcatc
agaccaaatttgataactcaacagtcagaggtttttccatatccttttttgatggctatt
gctgctggtgacgctgcgataccaaattcatggccttggatggtatctttgagaaaccgt
cgaactgagccatcgggacactattgtggtggatctttgataggcaatcaatgggtttta
acagcagctcattgtttcttatcagacccagatcctaaagcttatacaatcgcgcttggt
aaacatcgaagtttaattcatgatgaaaaggaaataactcggtatctcatcaaaatcatt
tctcatccaaagtttgatagagccacaaaaacaggagatttagctttggtcaaactcaat
gcacccatttcaccagttgaatcgtggatatcacctatctgtttaccaaacaaaatgctt
aaggttgaacctggaacaatgttgaccatcattggttggggtgacgttcaatcaactgga
aatccatatgttcttaaagaaggagttattcctttgatatccaatgcaatatgttctgaa
tggttgcaaaatgagactccagattccttgatgtgtgctggatacgaagaaggtggaact
gacacttgtaaaggcgacagtggtggaccaatcatgatgaagttaaatgacagttggatt
gccgttggtgttgcatcttatgggttaccctgctgtggatgtgtgagacagcctggtgtt
tacactcgagttgagcctcatttagattggatcaaagaaactattgaaaagaacaaatga

DBGET integrated database retrieval system