KEGG   Tetranychus urticae (two-spotted spider mite): 107368680Help
Entry
107368680         CDS       T04901                                 

Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00670  One carbon pool by folate
tut00790  Folate biosynthesis
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107368680
   00670 One carbon pool by folate
    107368680
Enzymes [BR:tut01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     107368680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1 40S_S4_C
Motif
Other DBs
NCBI-GeneID: 107368680
NCBI-ProteinID: XP_015792038
UniProt: T1KZ71
Position
Unknown
AA seq 183 aa AA seqDB search
MAIRNFSVIAAACENFGIGVNNKLPWRLKNEMNYFTRITSSTQDNSKRNVVIMGKNTWLS
IPEKYRPLEGRINFVVSRSIKDKPDKLDGLFKDLQTALEAASSSDKVENIFIIGGEQVYR
ESLNFPECHKIYLTIIDAKFDCDTFFPKFDEQLFKEIDELGVSKEIQEENGLKYTFHVYE
RQK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggccataagaaatttctctgttatcgctgctgcttgtgaaaattttggtataggtgta
aataataaattaccatggcgccttaaaaatgagatgaattattttactcggatcaccagc
tcaactcaggataattccaaacgcaatgttgttatcatgggtaaaaatacttggctttcg
attcctgagaagtatagacctttagaaggaagaattaacttcgttgtcagtcgttcaatc
aaagataaacctgataaattagatggtttattcaaggatttacaaacagccttagaagcc
gcatcaagctcagataaagtggaaaacatattcattatcggaggagagcaagtttatcga
gaatctttgaattttccagaatgccataaaatttatctaactattattgatgctaaattt
gactgtgacacattctttccaaaatttgatgagcagttattcaaagaaattgatgaactt
ggtgtttctaaggaaattcaagaagagaacggcttgaaatacacttttcatgtttatgaa
cgccaaaaataa

DBGET integrated database retrieval system