KEGG   Tetranychus urticae (two-spotted spider mite): 107369202Help
Entry
107369202         CDS       T04901                                 

Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00040  Pentose and glucuronate interconversions
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107369202
Enzymes [BR:tut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     107369202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 RmlD_sub_bind 3Beta_HSD Shikimate_DH 2-Hacid_dh_C Sacchrp_dh_NADP Polysacc_synt_2 NAD_binding_2 THF_DHG_CYH_C NAD_binding_7 TrkA_N F420_oxidored
Motif
Other DBs
NCBI-GeneID: 107369202
NCBI-ProteinID: XP_015792617
UniProt: T1L0X4
Position
Unknown
AA seq 244 aa AA seqDB search
MDISFKGKRALVTGAGRGIGRDIVKRLVKLGATVVALSKTKENLESLKAELPEIEIVPCD
LANWEETRKAVASLDTIDLLVNNAAYAKLDPIGEVDEQTCNLHFDINVKSIINVTQEVVK
KLKAAGKPGSIVNISSQAGMVALQDHVAYCASKGAVDQITRVSALELGPFNIRCNSVNPT
VVETEMGKRGWADPIKRQWMMERIPLRRFADIDDVVDAIVYLLSDKSAMINGVILPIDGG
FTAC
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggacatttcattcaaagggaaacgtgctcttgtcactggcgccggaagaggaatcggt
cgagacattgttaaaagactcgtcaagcttggagcaactgtggtagccttaagtaaaacc
aaggagaatcttgaatcgcttaaagcagagcttcctgagattgaaatcgtaccatgtgat
cttgcaaattgggaagaaactcgaaaagctgtagcttccttggatacaattgatttgttg
gtcaataatgccgcttatgctaaacttgatccaattggggaagttgatgaacagacttgt
aatttgcattttgacatcaatgtcaaatcgatcatcaatgttacccaagaagtggttaaa
aaattgaaagctgctggcaaaccaggatctattgtgaacatttcgagtcaagctggaatg
gttgctctacaagatcatgttgcctactgtgcatcaaaaggagctgttgatcaaatcact
cgagtttctgcccttgaattgggtcctttcaatataagatgtaattcagttaacccaact
gtcgttgaaactgaaatggggaaaagaggatgggctgatccaattaaacgacaatggatg
atggaaaggattcctcttcggagatttgctgatattgacgatgttgttgacgcgattgtt
tatcttctcagtgataaatcagccatgatcaacggagttattttacccatcgacggagga
tttacagcctgttaa

DBGET integrated database retrieval system