KEGG   Tetranychus urticae (two-spotted spider mite): 107369496Help
Entry
107369496         CDS       T04901                                 

Definition
(RefSeq) selenide, water dikinase-like
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00450  Selenocompound metabolism
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107369496
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tut03016]
    107369496
Enzymes [BR:tut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     107369496
Transfer RNA biogenesis [BR:tut03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    107369496
 Prokaryotic Type
    107369496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS BCA_ABC_TP_C
Motif
Other DBs
NCBI-GeneID: 107369496
NCBI-ProteinID: XP_015792944
Position
Unknown
AA seq 418 aa AA seqDB search
MDHGAHSAALQAVELEVSGSPHIAIHKPFDPEEHNLDPSFRLTKFAELRGUGCKVPQETL
ARLLEGLDENHTHQTSSSSATSSPSSPSYFMHQHMGLPKIGIGMDSSITPIRHGSLLLVQ
TVDFFYPLVDDPYVMGKIACANVLSDLYAMGVTECDNMLMILAVSQKMSEKERDTVVPIM
IKGFRDCAYEAGTSVTGGQTVQNPWLTIGGVASSVCQPNEYLIPDSAIVGDVLVLTKPLG
TQVAVHSYQWLEYPERWNRIKLVVSDEDVRKAYLRAMDSMSRLNRVGARLMHKYNAHGAT
DVTGFGILGHAQNLAKNQKNEVSFVIHNLPIIAKMAAVGRACSSMFQLLQGYSPETSGGL
LICLPREQAAAFCKDIEKQEGYSAWIIGIVEKGNRTARIIDKPRVIEVPSKEKDGELW
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggatcatggtgctcacagtgctgccttgcaggctgtagagttagaagtctctgggtcc
cctcatattgccattcataagccttttgatcctgaggaacataatttagatccatcattt
cggcttactaaatttgccgaattgagaggatgagggtgtaaagttcctcaggaaaccttg
gctcggcttcttgagggactggacgaaaatcatactcatcaaacttcatcttcatctgca
acttcatcgccttcatctccatcatattttatgcaccaacatatgggattgccaaagata
ggtattggtatggatagcagtataacaccaatcagacatggaagtcttttgttagttcaa
acagttgattttttttaccctctggttgatgatccttatgtgatgggaaaaattgcctgt
gcaaacgttcttagtgacttatatgctatgggtgttactgaatgtgataacatgctaatg
atcttggctgtaagtcagaaaatgagcgaaaaagaacgggatacagttgttcctattatg
atcaagggttttagggattgtgcatatgaagctggcacaagtgtaacgggtggacaaact
gtacaaaatccttggttgaccattggtggtgttgcctcgagtgtttgtcaaccaaatgaa
tatcttattcctgacagtgccattgtgggagatgtcctcgtgttaactaaacctttagga
actcaagttgctgttcattcatatcaatggctagaatatcctgaacgatggaacagaatt
aaacttgttgtctcggacgaagacgtaagaaaagcatatcttcgagcaatggacagcatg
agtagattgaatagagttggtgcacgtcttatgcataaatataatgctcatggcgctacc
gatgtaacaggattcggcattcttggtcatgctcaaaatttagcaaaaaatcaaaaaaat
gaagtttcctttgttattcacaatctacccatcattgctaaaatggctgcagttggtaga
gcttgtagcagtatgttccaattattacaaggatactctcctgaaacctctggtgggttg
ttaatttgtttaccacgagaacaagcggctgctttttgtaaagatattgaaaagcaagaa
ggatattcagcatggattattggcattgtagagaaaggaaatagaactgctcgaataatt
gacaaacctagagttattgaagtgcctagtaaagaaaaggatggtgaactatggtaa

DBGET integrated database retrieval system