KEGG   Tetranychus urticae (two-spotted spider mite): 107369577Help
Entry
107369577         CDS       T04901                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00511  Other glycan degradation
tut00600  Sphingolipid metabolism
tut01100  Metabolic pathways
tut04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107369577
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107369577
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107369577
Enzymes [BR:tut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107369577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 TPK_catalytic
Motif
Other DBs
NCBI-GeneID: 107369577
NCBI-ProteinID: XP_015793028
Position
Unknown
AA seq 297 aa AA seqDB search
MILFQLLTVFLVLNISLANDCVKRTYTADSFVCVCDADKCDTLDIQKTVEPGYIAIYDSD
QKTDRLDKTIVPVGQLKSRIDQTKNNQFTLNVNVTDLKQKIVGFGGCFTDGAVINIASLS
NDLVKSLMYDYFGENGLEYNIGRVPVGASDSSTHAYSLDDTPFDFTLSHFALAEEDTKYR
IPLLKVAKMLNPEFRAFASAWSSPTWMKTNHLFHTAGGLIWKPGDVYYKLWAQYYVKYLN
AYLDQGVKFWGLTTENEPIEGTRGLPWGTLGMTPEDIRDFVKLDLGPALKAAGWGQL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatattatttcaattattaacagtttttctggttctaaacatttctttagcaaatgat
tgtgtaaaaaggacttatacagccgattcatttgtttgtgtttgtgatgctgataaatgt
gatactttggatattcagaaaactgttgaacctggttatatagcgatttatgattcagac
caaaaaacagatcgtcttgataaaaccattgtaccagttggtcaattaaagagtcgaatc
gatcaaactaaaaacaatcaatttactttgaatgtaaatgttacggatttaaagcaaaag
atagtcggatttggtggttgtttcactgatggtgctgttatcaatattgcaagtttatca
aatgatttggttaaatctttgatgtatgattatttcggtgaaaatggtcttgaatacaat
attggacgagtaccagttggtgcatcggattcatcgacacatgcttattccttggacgat
actccatttgactttactctatcacattttgctcttgctgaagaagacactaaatacagg
attccattgttgaaagttgcaaaaatgttgaatcctgaattcagagcttttgcctctgct
tggtcatcaccaacttggatgaaaacaaatcatttattccatactgctggtggattgatt
tggaaacctggagatgtttattataaactttgggctcaatattatgtcaaatatttaaat
gcttatttggaccaaggagtgaaattttggggactaaccactgaaaatgagccaatcgaa
ggaaccagaggacttccttggggaactcttggaatgactccagaagatataagagatttt
gtgaaacttgacttgggaccagctctgaaagccgctggttggggccagctctga

DBGET integrated database retrieval system