KEGG   Tetranychus urticae (two-spotted spider mite): 107370558Help
Entry
107370558         CDS       T04901                                 

Definition
(RefSeq) putative glucosylceramidase 4
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00511  Other glycan degradation
tut00600  Sphingolipid metabolism
tut01100  Metabolic pathways
tut04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107370558
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107370558
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107370558
Enzymes [BR:tut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107370558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Tox-PLDMTX
Motif
Other DBs
NCBI-GeneID: 107370558
NCBI-ProteinID: XP_015794023
Position
Unknown
AA seq 244 aa AA seqDB search
MMRDYIKKDLGPALKKAGFGKDKVKLMIWDDQLLDIMPFIRVILEDKEAAEYVSGVAYHW
YSRRFYELLDEIKMTYPQVFLLSTEGSEGVYAAERVSLGNWTRAERYATDIIEGLNHWST
GWVDWNLALDESGGPNWVNNFIDSMVIVNNTSPEYYKQPMYYVFGHFSRFLRPGSTRLGH
SIIKNNAENEVKLTVFQTPTNDTVLTVLNKKSAPIKLTVEGMNVKPFTLTFSPKSITTIV
NASH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatgagagattacattaaaaaagatttgggtccagctctgaagaaagcaggttttggc
aaagataaagtgaaattaatgatttgggatgaccaattattagacattatgccgttcata
cgtgtaatcctcgaagataaagaagctgctgagtatgtttcaggtgtagcctatcattgg
tattctcggcgtttctatgagttattggatgaaatcaagatgacctatccacaagtcttt
ctactttcaactgaaggtagtgaaggagtttatgcagctgaacgagtatcattgggaaat
tggactcgagctgaaagatatgccacagatataattgaaggtcttaaccattggtcaact
ggttgggttgattggaatctcgctctagatgaaagtggtggaccaaattgggttaataat
ttcatcgattcaatggttattgtcaacaatacttcacctgaatactacaaacaaccaatg
tattatgtttttgggcatttcagcagattcctgaggcctggttcaacacgtttgggccat
tctattattaagaataatgcagaaaatgaagttaagttaacagttttccagactccaaca
aatgatactgttttaaccgttctgaacaagaaaagtgctccaatcaaattaacggttgaa
ggtatgaatgtcaaaccattcacactgacattcagccctaaatcaataacaacaattgtt
aatgcttctcattaa

DBGET integrated database retrieval system