KEGG   Tetranychus urticae (two-spotted spider mite): 107370866Help
Entry
107370866         CDS       T04901                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00010  Glycolysis / Gluconeogenesis
tut00562  Inositol phosphate metabolism
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107370866
   00562 Inositol phosphate metabolism
    107370866
Enzymes [BR:tut01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107370866
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107370866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 zf-C2H2_2 p47_phox_C
Motif
Other DBs
NCBI-GeneID: 107370866
NCBI-ProteinID: XP_015794310
Position
Unknown
AA seq 452 aa AA seqDB search
MILILIIFILTIPVDIFSDKACDNFDKKGPYCLFSSKNDIKRVYAAKTKYDQSVKLFAKL
ADSIDIPSTCKPIMFYLFSRHGIRYPEKDDIIDMEEILPKLQSEIINGYNSDQSELCEQD
YQTVKDWKLQMVPENDNHLTSSGVETTKKIAGLFYERYPSLFDPSEVEFKVGITSKVRTN
ETAHAFVDGLRDLRPDININEEDYVIRNHLQFHSICKKKINGKIPEPRQVKEITESKLFQ
KLRQRISKRMGLNRTIDDAELSVMYKSCCFEQAIYEKAPWCSLFTKKELRALETREDLKH
YYRNGPGLYLNHQMPCPLIGDLYRAVIKGIAQPENKTTYLYFSHAGALARLWAALGLFDD
LEINHNFCPDENRKWRTSLMLSFNVNFDVVLHRCTENNKSTNPSDYKLLTMINGFPVKID
HCDDSMCNASKFLKKYKKMAESCDLDQICHLP
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgattttaatattaattatatttattttgactattccagtggacatatttagtgataaa
gcttgtgacaatttcgacaaaaagggtccttattgcctatttagtagtaaaaatgacatt
aaacgtgtttatgcagcaaaaactaaatatgatcagtcagtcaagttgtttgctaaattg
gctgattctattgatatcccatcaacatgtaaacctatcatgttttatttattttcaaga
catggaataagatatcctgaaaaggatgacattattgatatggaggaaattttgcctaaa
ttacaaagtgagattattaatggatacaactctgatcaaagtgaattatgtgaacaggat
tatcaaacggttaaagattggaagcttcagatggttcctgaaaacgacaatcatttgacg
tctagtggagttgagactactaaaaagatagctggattattttatgaacgttatccaagt
ttatttgatccgagtgaagttgaatttaaagttggtattacttctaaggtgcgaaccaat
gaaacagctcatgcatttgttgacggactacgtgatttacgaccagatatcaatattaat
gaagaggattatgtgattcgcaatcacctccagttccattcgatttgtaaaaagaagata
aatggtaaaatacctgagccaaggcaagttaaagaaatcactgaaagtaaattattccaa
aagcttcgtcaaagaatcagtaaaagaatgggattgaacaggacaatcgatgatgcggag
ctgagtgtaatgtataaatcctgttgcttcgaacaagcaatctatgagaaagctccttgg
tgctctttgttcaccaagaaagagttgagagctttagaaaccagagaagatttaaaacat
tactacagaaacggacctggattatatttaaatcatcagatgccttgtcctttaattggt
gatctctatagagctgttataaaaggaattgctcagcctgaaaacaagacaacttatctt
tacttttcacatgcaggagctttagcaagattatgggctgctcttggtctttttgatgat
ctagagataaatcataacttttgtccagatgaaaatcgaaaatggcgaacctctttgatg
ctttcattcaatgtaaatttcgacgtcgtacttcaccgatgcactgaaaacaacaaatct
actaacccgtctgattacaagttattgactatgatcaatggattccctgtaaaaattgac
cactgtgatgattcaatgtgcaatgccagcaaatttctcaagaagtataaaaagatggct
gaaagttgtgatcttgatcaaatatgtcatcttccgtaa

DBGET integrated database retrieval system