KEGG   Tetranychus urticae (two-spotted spider mite): 107371739Help
Entry
107371739         CDS       T04901                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: retinal guanylyl cyclase 1-like
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00230  Purine metabolism
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107371739
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tut01001]
    107371739
Enzymes [BR:tut01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107371739
Protein kinases [BR:tut01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107371739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 107371739
NCBI-ProteinID: XP_025017828
Position
Unknown
AA seq 566 aa AA seqDB search
MIDLRNYNLVDFKGLFDNHHIVHHDQAFSTLYPQIGCFTVWEYCARGNLQNIIKSKCIDF
DWSFKLSLLFDLSNGLKYLHSSIGKHGWLTSADCVVDSNWLLKITNFGLMTLYQTISNEN
NENVDCFQPTSSHLLWSSPECNKNESLKKVKLNPCRWGSKESDVFSLSIIMSEVINQSSP
YNSQDSKTTDSIIRSIGSGIYVRPTVDSTDVPDDIIDLMEQCWSDNPDRRPSIDDIHEKF
SAHSEGKXVKIIDSMVHKLEKYTINLEAIVASRTLKLEEEMKKTESLLYRMLPVPVADAL
KLGQTIEPDKFEEVTVYFSDIVGFTTISAYSRPIEIISLLNDLYTSFDRIIDSYQVYKVE
TIGDAYMVVSGVPERRSDHAEQIADMALDILHSCTQIKIAHLPGVPLKIRIGINTGPVVA
GVVGTAMPRYCLFGNTVNIASRMESTGRAYRIQISKRTMRHLRTTGIYHIEYRGEVDLKG
RGKKSTYWLTGKDGFNKCLPEPEDDDGANHGFKDCEIIEIFGPNNKTSSDVSPSSPTGSV
SPIDVFELNSLTKQNYSTGNVLQVPK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgattgaccttcgtaattataatttggttgattttaagggtttatttgataatcatcat
attgtccatcatgatcaagccttttctactctttacccacaaattggttgtttcactgtt
tgggaatattgtgctcgaggaaacctccagaatataatcaaatcaaaatgtattgacttt
gactggtcatttaagttgtcacttttatttgacctttccaatggtcttaaatatttacac
tcgtctattggtaaacatggttggttaacctcggctgattgtgttgttgacagtaactgg
ctgctcaagataaccaattttggactaatgactttataccaaaccatttccaatgaaaat
aatgaaaacgttgattgttttcagccaacttcctctcatcttttatggtcttcacctgag
tgtaacaaaaatgaaagtttaaaaaaggttaaactaaatccttgtcgctggggatcaaaa
gagtctgacgtcttcagtttatccatcattatgtccgaggtgattaatcaatcatcacct
tacaatagtcaagattcaaagactacagattcaattatccgctcaattggttcaggtatt
tatgttaggccaactgttgattcaactgatgtaccagatgatataattgatcttatggaa
caatgttggtctgataatcctgaccgacgtccatccattgatgatatccatgaaaaattt
tcagcacactctgaaggaaagtaagtaaaaattattgattcgatggtccacaaattagaa
aaatacacaatcaatttggaagcaatagtggcatcgagaaccctgaaattagaagaagag
atgaaaaagactgaatctcttttgtatcggatgcttccagtgcccgttgctgatgctctt
aaattgggtcaaaccattgaaccggataaatttgaagaagtaacagtttatttcagcgat
attgttggttttacaacaatttcagcctactccaggcccatagagattatttcacttctc
aatgatttgtatacctcttttgatcggatcattgattcataccaagtttacaaagttgaa
accattggagatgcctacatggttgttagtggagtcccagagagacgttcagaccatgcc
gagcagatagctgatatggctctagatatacttcacagttgtacacagataaaaattgct
catttacctggtgttccactcaagataagaattggtataaatacaggtccagttgtggct
ggtgtcgttggtacagcaatgcctcggtactgtttgtttggcaatacggttaacattgct
tccaggatggagtcaactggtcgagcttatcgtatacaaatatctaagcgtacgatgaga
cacttaaggacaactggtatttaccatatcgagtatcgtggtgaggtcgatttgaaagga
aggggcaaaaagtcaacttattggctaacaggcaaggatggtttcaataagtgtcttcct
gaacccgaagatgatgatggagctaatcatggattcaaagattgtgagatcattgaaatt
tttggtcctaataacaagacgtcatctgatgtgtctccttcatcaccaacagggtcagtg
tcaccaatagatgtttttgagttaaactctttgaccaagcaaaattattcaactggaaat
gtccttcaagtccctaaatag

DBGET integrated database retrieval system