KEGG   Tetranychus urticae (two-spotted spider mite): 112539571Help
Entry
112539571         CDS       T04901                                 

Definition
(RefSeq) titin-like isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Brite
KEGG Orthology (KO) [BR:tut00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tut01001]
    112539571
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tut04131]
    112539571
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tut04812]
    112539571
   04147 Exosome [BR:tut04147]
    112539571
Enzymes [BR:tut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112539571
Protein kinases [BR:tut01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112539571
Membrane trafficking [BR:tut04131]
 Others
  Actin-binding proteins
   Others
    112539571
Cytoskeleton proteins [BR:tut04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     112539571
Exosome [BR:tut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112539571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set Ig_6 SH3_1 SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 112539571
NCBI-ProteinID: XP_025018024
Position
Unknown
AA seq 12304 aa AA seqDB search
MLMTWALFVNVAAFLSKKRMEKRRKIEPFQSSLTHGGNQRQMTSMSTSSRTFTIKSTSQR
YSSDSPMDKEGFDVEQFENGLLNNSSFRETLISSINNDERSQWNKENEPDSFSRSHEQPR
MAPKLISKLKNGIILEGSDVTFQVKLTGNPKPLVYWFKNGLPLVSSSRINCWQQKVDQGI
NGNTIVTILHIHMALPEDSGYYTLLIENDLGRLTTSSHLIIEPMDETIRLKYFTSNQSNQ
QETVNRSQLSASEDQSHSLLHQGLQPHFTRIPNDSQVAEGKLIRFDCRVSGRPSPEVFWY
HNGSLILDDGRYKIVVNEDGLNSLMIQSVEKSDSGRYMCVCRNIHGQEAFEVNLTVIERQ
SCVPPKFIERFTVQYHQPGDNLVLHCRSLGTPQPTLTWLKDAHQIYPNPPRVVIETHGGT
STLIIHGVTPSDDGWYQCTAQNPSGSTATRARVHVFRGSEYSPVGRSPTPDSLTGRRTPN
RPESRQSYHHHSHHSQVTSTSMRSVDYYYQQEPISETIQLRHVTRPAPIRRLDSEEPWTR
TNQIPPSFTCHLRDLTLIEGDRAYFDARLVPIGDPSIVVEWTRDGRPLEDSSRIMTTYNF
GHVTLTILRTKKSDAGVYCCRAWNSLGETTTTAALNVFDKQTIQQKSLFSSSANILQSSD
FPASSLVEAPTTPPTFIKPLIDLGKLYENGYAHFEAQISPFDDPHLTVKWFFNGKPLTVG
SRISTIYNFGYVALNISYLRVEDSGDYTCKVVNRLGEAVSTARLKVVSSESLPLTFTDEP
KTAFLTGDQVNKRRYQWCISEEEGPKTEPRFVEKLSDVKGIHVGRTVHFEATLEPQGDPT
MKVDWYKDEKLLEASSRIKTFFNFGYVALTIERTEERDVGQYKCVAINKRGSDSTSAILQ
FIEQDHPDYQPSPVQPIRQTKETWERYRETEDITRYNRIEVEEIELQRKPSFTSPLIGPE
TVVEGEDVHLETRYSPKSSNISLIWLHNGSPIDMNDRRFSAISHFGYAALDIRPTKSNDS
GVFTVIATNEKGEQAEVARSILVTPSPSTSLTYEAGVERRQTKLSSSSSQSHIALSRSSS
TIQVKPYFIQPLTQPTVHLIENQHVHLEAQVEPAHDVELQVTWLRNGRQLPANPRYTTRV
DVGFITLDIVDLKPEDIGEYTVIVTNSLGSASSSASLKMQGYTPKTPETYGKDFNPFKSQ
FEKDVQQRYQSRVDTELAASKRDKESKPKFIVPPPSYTVDEGQSLTLETHFIGNPTPTIK
WFIEKRQITSDGIKYKITNDTDAGVSRLEIFKTTSNDSGRYTCEATNKYGTNTTSSLIDV
YKSGERPRFQSELTVLTIRPGQPLELKCRVAGFPSPMIDWFHNSIPIHQSEVTSMTYNSE
TGDASLTIHNVTTEHSGRYSCRATNQYGVEESSTIVNVLPDLPYDSSSSRPTFYRPLGPM
VIPLGHPARIIVEYEVKQPFQARWYHNGIEITSTDNIRIETTSNTSSLTIYRVGPEHVGP
YRVTISSISGEATTLGDLSIIESVPDSSKRSVEFKSILSSQQQQQQQQQFTTIQSHSTKQ
FLSYKSAKSNIHQIGDTSSRTSSVPPGLDRNRLPSAPLGSDRLDRGSQPLYGSDAIDSRL
LSQATISLDELRGDGLSTTPQQMTTLPLDNRQRLQRQPVTLTSKTVTHPSWPEQASSTES
ISRSQMYRVTRVSSASPERKSVSPHFPHHRPKMPVNTVEDRISSPSGLPKAPIKHVANLE
WKPQRLVFPVSQMLEDEPTMFISKDSATLKPTDKVSVSPSIKPVFSSIPVDEKSEVKLTI
ESTKKSYWETSTTRKTTTVMMATESDKRPEGEQSGSQKVVQRMEKVTLELKPPIVNFLFE
EWKSDDESGRNEIYYDTRGYSFPQKQPSLQPTSTSIIYQPYQKATLELPCPRLTFTFDDF
APTNLIAPSPELIDLSAYLYQEDETPKSLEPLFSVEFEIPCPMIYYGTAPAGSESVSLSP
IGIETISGEIIRPDSVMSERSDDVDMIEDRPRGLKRSASLHITRVVEPSAVVYTVPCPIY
EYRFQEVPIDKHGRPLSGIFDLSAAPPSPGILKSESGVIDVEALYALGYLKNLIATIEIP
NTRITFRIQGKAPKPLSVSAGLADGQTSDQPEELLVITEYEVPFQRLETKRPEGLLSQPS
TTGLGSPLQPTTQTRLKEQPMTSETSLPFPKIFMSLHEDMMPSQSTDEANPQVISISQQY
STQLNRYETLALIERQYGPLPMTSAQTQPVSPSTVREEFREVTIRSQGKRRSSKTMKTES
KTLLKEKDKPIKEKKSPPKEENWTWTGLTIPVLTYVFNFPIPYIANYFVPCSKLEPSEEV
SSQFYITISEKIQKIISIDQLKPTSTVSESSSGLRVTDYPLPVDVVRDFIVSEGFIELTV
TQSEIELLKRQRPPYVRDTVPPMLITIRSQARPKQIKQSVKRSEVITIKTSSKQTGIVDV
KQQPITQSIEVESTAKPTFEAERVRYETIQPSVQIVHSVPESDHVSQPQETMQTEISSKS
TPYNQIVYQVDLPKDQSLTTHQSYESSQMIHKVEKVTPTPIYISHPEMIQQPESRQQTSL
DMTPKQVQPTTTHIQQSPPVAPKPIHRQPLGTPIELTIGKKTSQFKQPAESKLEITTQST
EIPVNELVDVTQRPDYQQNINLESYGRPYERTDLNRSIFQSVTKTTTIETSPVVTIDRPA
SVLPITQTTSTRFSEQMEREPTKVTTETLQTHTASYQLPSPQLYYPYQDDSQVQMPFQPQ
SQTPLAPVRSKVKQVPQPLQSKLVVQQPVERQGDSGEAKAQPVKPMVTSFETPTPRITYP
FQTDSERPEQFITGMTPHPGYIGYPDQEKFIPEVALASTSREMTIQTQSKTLTQLQKQPT
AGSSIIVTKMSTQKRIESTRAVSQPQISSSSEEFVDIKVIDSQKRPFDVSSKALPQHFTE
SITKTKDTQPTPKSVIYKEDEKQHARETVSAAIESTMRAEKMIPYSIVRYHVPDESQMQQ
PEMPRDVHITSKGRSQSKIVMESTKVEITKSPIQPKTALMDQSAPETSPFKASTTSLQMS
KEPTPTQKPIDQPAFMPREVTIKSSGKSRSESQLEKSSISQTISKQVQHRFLSDSELPSF
DSASQITFDNQQLAQAQSDLVQQPTLFESQKLYTSSQRSFETRVDQPYQRVEYRPPSELQ
PQIVPKIDEGIQKTAASQYIQHVLAPLVKAELTLPHPMYIFNVEEIIVRTKETEKPAIDE
TKSTLMTLTQQRKQKAVDTITKALSPFIVSLEIPSPRWVFYIKEIRVRTSSKERDQIFIS
EIVTPYHEIPAVSPAYVEMPPAHSSTYESQAQQTLLLTDFKGPESRETVTFTDQQSTTPA
MASFIDIQETESERRRRAAATIHSVISPLIRTESFPVPSYPIEPVSQEFRLTSKGRTKVD
QRFERSSLEVTKSVQSTSYETASRDIPSLVSIDQMVVDQQTRLQTSVHQIESTSSPLLHT
EVRLPQQFVEDQSIREVRITSKGQKTSEARLERTVISAESKPVAQLLPERAELPDKPSDD
KDVARSYLQNILQPLVQMEIPYPRLLFPVPADLESVQEMTITSRGRDRQEAHLETFEATK
LVSTMDFENQPETDSTTKTIIQLKRTEKHKKEKKIIQKQVTESVEGQKPLQFPTRDVTIK
SKGRERSLTRLESTEIEVETKPKSIEIETVDQPSSVDTKVLEPSDTKTSQTIQLSKPEKI
QRPIQVKTNIIEQPSMPVEYPLRDFTIKSKGRERSLTRLESVEMEIEINKKVEQPIIDET
QIIPDTAEIPDADSKDEALIEAQTVIQLKKPTRREMVEKIEDSPGPKSPSVRDVTIKSKG
REKSLLRVESVEVELDKKKEPNLPIEIKPLKETEDTRKDTKEIQLSKPVIIKKKIPGETV
IFYVPEITRKPSLIEEPISSTMKIEKTTIEIEKRKKIEQPEQVELSTETIMITSEAKEIV
DSGKPLETDEHLVLPKKQEVSAKPSIVTQEAIVIAEGTIDGSTKSLETKIPQEKASVDLT
QSKAVTIDETGPVEKETALKAPIHPKSKHARVLKGVPKQRSLSIEGKQLMETELPLTVDQ
PETSHLIPVKTDQTPIASAQVSEAKLEEKTLPIETVDTKVRRASIKTTVPKRRSVSIERK
DLMEKELLRKVPEISICKASIDLVPPILAFQVTVQSIMETEQPISVSPETTEHHATSSFD
TSKAVTVSDVFAPQEVVAFKIPSTKSESASVEVTSFTAPESRVEFPCEIEQPQTPEKPKT
SKVKVKAPVKTKHSLIVQQKDSFEKESELQPEVVPDKGQGSVSLTSTSAISVSTRDYLEA
AEKPLEIDSIKPKVATQSVVDKTSAALSISTIETGESETVQLSKTPLDKRPSVSLTESQA
IEVTTSIPGDTEKNLEEKAKPEKHKLKKKVDIKKQKPISIESQHPIESVGSIDKMDQPLE
QVKESISPITPLTVSKTETVEESEKFSQPQTAKLSQAAQSMTPLTQAITVQSIDTINFES
PLKVDQPIVEVARIEIPTSIAIEASLDSLIEAGPEETKSVQPKSQKVKPRKLIKPKHPLQ
VTQGESFERELDLPLDNTMVQTISSSIEITTRTAFSVSSSDLIEEATVSTALDTVTSVVE
ESKTIETKHKPITVSSIETLETTDSISDVRPSASQPTVDITQAQALSVVESITGETEQLY
AQPITMEAKRMRSKIDLQEKRTLSIEAPELVENVVEAVTESKPSDVAKQSLIPEKSVTID
LVQSMEKVETLTTTSPQIKTIVSVLSDKINTPMTITMEVPNDNEKPLITQEMKPDKGVMN
VETSIAIQATEATFSMKETDFIEQKPVSASATAKQIEDDKKSISIESKETLEKEGELSVP
TSKEENLTISSSVITQQAMEITVAIPGEMEETTKPEKPERKKVTKKTNLRKLKSVSIEKP
ELSESIVPIETTQQPTNQAAKSIESDQSIIVSDNQIIEQPTELNIEYPDAKQSSSTLTDR
NLHHLEVSLQDIGVKESELALDKPDESNADINISPSTAMIGTQVISNEKEITIEVGVEAK
PSIQLEFEAEMRKFKSISIEKRETLEMEGKFETPLPRKEKLSKKTSISKKRSVSIERPLV
MESESSTDIQIQPEMKLKESKVDSKSSFATTNIQQESLESESQLDQPIVKSSQADKLIES
IPQALTVITSDVSQDEIPLDLPKETSSSASIDIPTMIVAESRVDQVIEKEDISTIDENIS
KPEKKKVKVKPTIRSKQSFEVIQKDSFEKESPIETDKTEVATQKFEETGKTVATVESKQL
METETESFISPDQSEYVIPKLTEELNRTITIQDSQPIELEESVISQKLPTVQPQVAFATS
QGITITAQIPGETETILPEELKPESHKLKKKVDLKKQRSLSVERPVTMEATENIPISENK
KETASQLLSPEASLVVSTIESVENTVKLEIEIPSEKTVVKSISESVYHSYEVNIPVADLA
ETDLKQIPHTSSKAQIGITESEAASGIISQPVESEVTLDVDSLPEKVKPTKTLTKKKSRS
ISIERKQSYEKEDKLDVELCKPESAKPDISDTQAISIGIDVPIEKEEQLKEDVKPEKKKV
KAKRPLSKTRSASIERPQLMDKEDEFDVKKPLVVTATTSMVPQKTIESSTVDTLESEQVV
IPIDESQIAEKTAKISTETKLLEKVKSSEKLLTMIGEPEIERPKIEQEIEIESKGRKPIR
KEIIQTFKKVGDKITSIQVESTQYEDSIVDITMEQDSKQEIDIESKKKGDLFVEELTTEF
GESPTPTTTKMEDSISIELPEEDQEVISKEKDKSSESIEIMPDMDIKVESKGKKDKKKPK
FSERFGVHRNVADIQVEGKSDIDNIPVDSSSENLEQIDSLENVPVVEMEMIKDEISDLIG
EAPEDTKPVDEDEQDKSEIKVKTHKAKLKIPGTRVIYKVPGHRARSPRIDTFESPEIPGY
QVVKLSIPGKRVIFRARPKGGKHSDQEEEIVPEKKSGLTMDLKMDQIEQKEEKGDLVGVE
ESEKSQRVTIRSKGRMKSLQRHEAVDLEIDIDNQEHYETFEMIGDEVQPEVIQEDEKIVT
TKLKITGRKIVFKVPRRMSQPEIESEMVIDQPAQIEIPDIIEAQTTIELKKPDQKPVEVV
KQSESVELEKSIPVQEVTIKSRGQQKMETQLESESIEIEKAPKPSLQETESEDLRPVETS
VELQIKEKETESEMVEKDKQTETTKVKISGRKVVFRVPSKSEEGETVEKLSEIETSIDQP
EEQPKKVETQMKPKRPSIGSMQEIIIAAKGRQKSSSILESTQIEAEQVMTEEDIEESVKI
NITGKRIVFRVPRKLCLEDATVSEELEQPKDIEEQEIAEITDDVPATDEMSSIDIKGKRI
VFKVPRRFSKEQIMEAEESISETTQVKITGRKIVFKVPRRLSQPETEELQISHDEADISV
SEQVEVDTQFNAKEDIELQLEKEKVREDLEMETQPDSVQEISITSKGQEKSDLEIVSEQI
EVVKEITETTTPDGVTDATVPDKIKKTKKKIKFEEKPAEDYKSSEQIEIEKELEEEEIKK
VEIETQPDSAQEISITSKGQKKSEIKIESEQIEAIKEITETTIPDGVTDATIPESDKTKA
KKTKKKIKPETKSIDVTEEESRSEAQVTIELRQKIEATVEKDEGEKLEIEIQPDSAQEIS
ITSKGQKKSEIRIDSEQLEVTKEITETTIPDGVTDVTVPESDKEKIKKTKKKVKPKDKPA
EEFKSTEQIEMEKEIEEKEVEKVEIVTQPDSTQEISIISKGQKKSEIKIDSAEIEAVKEI
TETTIPDSITEAAAPEKIKKTKKKVKPTEKPEEDFKSREQIDMEKTIEEKATEKVEIETQ
PDSTQEMSIMSKGRDKSELDIDSEKMEITREITETATSDVVTDVTIPEKDREKVTKTKKK
IKPKEKPAQDFKSSEQIEMDKDQDQEISQDVSISSKGKDKSEILIESENIEVEREPVLLI
AHVDEEDKPDLERKDSIVIESGKTVMIKKKIPGETVTFHVPEITRKPSLIEEPISSTMKI
EKTTIEIEKRKKIEQPEQVELSTETIMITSEAKEIVDSGKPLETDEHLVLPKKQEVSAKP
SIVTQEAIVIAEGTIDGSTKSLETKIPQEKASVDLTQSKAVTIDETGLVEKEVELKSPIQ
PTSRRAKVKKDITKQRSLSIERASVMESESSLPSDKQEYQLAQVDLTLLDTAAQTVSSSP
FESTKLLTDQTDQVSSADLHIDVNSAITITSATTIHQETCLPDIDKPDTKSASVDITPLT
VPEKRLEIDVMETETPASDDTPDSHKIVPKAPIRVKHSLIITKGQPIETEKTIESSSIEM
SSTKVEVTPSSSLLITQSQPLETEVNIEKSESTRQLASIGLSDEQNKPLSVSSTEIIETG
SDLKPEITTTEKPKIGFTESHSIEITSKTIGESEKELAIPVAPERKKGTKKVNLKKQRSV
SIERRQLVDSVTPIVNDEAPRDKAKESILPKTSKSLSISTVETNESTELEKPVDTQMERA
EQQLTSSTAFTVGLDESVEREGELKMPTQVKDQVTEIHDDLPRKSSVIVSNYPLMEKEGT
AIIDQFNKSRLEPQSIQEAISVPSVSQISPFETEKLLSTEIPDSSEAQASLTMSRELNVE
DNEIVQQVLPLDINIRHPGEALTDIPTMMIAESQVTMPAEKESEIKEPEQETRKIKPKKP
LKPMHSLEVQSEEPFEKETDLVTKLTTDSASEMTQLTLRSALTVATPSSLEAYQDSDIAD
VCKPEEAESVKTTQIVESINITTTQPIETTTATSDEKIDWEVPTVSLSVSSAATITEKIA
GETESSLEKQPIPETKQATTKTGDLNKSLNINAQQPIETVGAITSTQQTEQKVVSDLVPG
KAIVISSNETIENIVTLTIESPAVQTVSSVLSESIPLEVTSNEIVQSEVELETKTPNIQK
PSMSVSTSEAIQVSLEAQLNSEVPLEEQEVPRSAQATGKVKELEQRSISIEKREILEKEG
DLKSDKPKLDKSTKRRNLVKKRSVSIERPQILEASVPLDTSLDKSIQIEQKDIPKKSVIC
PEVSQPSTLEFPKAFDQETPDNMQTAERNFESNQAIQIASLDALIESSGIAPDNEIPNSV
TGVVVTTINQVNPLIIAQKDSFEREGEVESIPSEIASATLEPTTRTTVSVASPETLEAAE
RVEVSLDHSATAQKRLTTESNRSITVSQVQTVEIGSVVEEKPLIPVIPTIGLTENQAVEI
ASATLGEVPESLKTKMPREKRLEGKTTLRKQRSASIERPIIVETVADVETKPETLDKAKE
QLVPENSIAITTHQTVEGVEDIQVQAAIMTESDFTHVSHQAIEVSAQQFVQSEEQLSTAS
PEKVKVKPIIPENTKTVHKTYQSQPMECEGILDIDEVKKGKVKSTIESVKHRSASIERRP
TYEKEGEILIKPSNEETIDATIEQAEAVKVSQHDLIEKESEYEMPDAPQSSKVTIKTPIV
TQQAMEITVSIPGEMEETTKPEKPERKKVTKKTNLRKLKSVSIEKPELSESIVPIETTQQ
PTNQAAKSIESDQSIIVSDNQIIEQPTELNIEYPDAKQSSSTLTERNLHHLEVSLQDIGV
KESELALDKPDESNADINISPSTAMIGTQVISNEKEIPIEVGVEAKPSIQPEFEAEMRKL
KSISIEKRETLEMEGKFETPLPRKEKLSKKTSISKKRSVSIERPLVMESESSTDIQSQPE
MKLKESKVDSKSSFVTTNTQQESLESESQLDQPIIKSSQADKLIESIPQALTVITSDVSQ
DEIPLDLPKETSSSASIDIPTMIVAESRVDQVIEKEDISTIDENISKPEKKKVKVKPTIR
SKQSFEVIQKDSFEKESPIETDKTEVATQKLEETPKTVATIESKQLLESEESVPIMDQKP
ESASESIPLINRIALSVESAKSLDSTQPIEGATSDLNKATIKTEEKSTKPVTISTTIAAE
SEAALQTESIDMQKSQVTVTETHALKITTQVTNEIEGILAEDKPITQRIKKSVSFKEQKS
LSIEKPTSLESTSNLDHSKQDEDKARKTMDEEQSLNVTLDQPYDSIEKFQTEQSPAKTAS
TEIVDLTNKAIQISIQEPVMSEEKMDTIKSEESIAELNLTESEAASGIISQPVESEVTLD
VDSLPEKVKPTKTLTKKKSRSISIERKQSYEKEDKLDVELCKPESAKPDISDTQAISIGI
DVPIEKEEQLKEDVKPEKKKVKAKRPLSKTRSASIERPQLMDKEDEFDVKKPLVVTATTS
MVPQKTTESSTVDTLESEQVAIPIDESQIAEKTAKISTEAKLLEKVKSSKKLLTMIGEPE
IERPKIEQEIEIESKGRKPIRKEIIQTFKKVGDKITSIQVESTQYEDSIVDITMEQDSRQ
EIDIESKKKGDLFVEELTTEFGESPTPTTTKMEDSISIELPEEDQEVISKEKDKSSESIE
IMPDMDIKVESKGKKDKKKKPKFSERFESERPISDIESPEEVVTLPTKKPTSKPDFTERF
EIDQPEEKMDNLIAEGIESIDNAESSFTIKAQEKVQGPESTSEVDVATIVSIDESPKETL
PESDDSVFLDVPAPTDVSEITLETKPKDREETEDEIAFAHATSKAKRVRFSIGDAILQPG
ESIDGSETISIDMPMETTVFSVPEAEKDEKPEESSKVSFKLSKPKNELDETETSVSLKKE
EPSKPLVESTETEQATFSFGSRKPSVEQEDVSETFTLQSSEKTVFQVPDVEQETSVSVDF
VLPERKQSFVSPSPFLESVETVVDAPLFKKETSMENQVVTFQVPGYVEEEIIVSTEIVVP
TEKQMFISPSEIPVETEKIELKDKKETTETAILETSSQPIHFQVPDLPVEANEVVDLEIP
CKVQSFVQPKDEKIEEKPIETSVKKIKKKQETVESTSIETTGKPIVFNVPETLKESTQIV
TVEIPDRKQSLIKPEVNLSETEQPTSPTEVIASKEKPKDEIKIESVELTIPEKETVFQVP
EITEQTVRSDINIPCRRQSFVSPSSIPIEESKRKKSVAETANESTTIETTGKPIVFKVPE
TMDENVSISLDIPGRKQSVVKPTPLPEEKEETKIVESPEKVTESEELIVKSEKPEEDQEE
TTTVSFKQKKPEHSVPEEISVSLKARKPSIGDKDTPIQEDIETSITVKKKPKKRPSDAEA
VSMVSLTMPCRETAFTIPAETSIDIPKRASITTVDTVTEAVKPEEMPEEKQAEETIDTIK
LRKPSKEQESPVEVSIVPQKDHETPVHVESIKLPKKEEQKSQPEEVTSVQLKAPISVPEE
VETTSITLKKSSIPDKPSEESQLTSEFKLTLPTKEDANVQEIEKPIVTMETSIAIKKKPK
KKKEIEASSTSLTIQSKPEEATVPEKEAATSELTLSTEKVSISPRRTSFQSPENIPEKPT
KEIVEQIIKPTEENKEEKPEEDKKPIEVAIKLRKPSAPQVEAEAVITKQRKELENMDTEI
VIKKKPKKKSADAEMTTIVTKPAIEEVKVPSLDVEAELSIVKTDQVSMVGEKVEFSAPEE
SKDQPEVSSVTMRKPSKDYEEDLKAEFKIPKPSSVEIDVSEKPKEVEDSLTEITIKKKPK
KTKKEVAVEEAVTISPTVTEETKPSEIEADELTIRKEVEIPGEIVTLKPDLDETTSVEVI
KPEEKPDIKPEETETQAEFKIRKPSLPVEATIIDKPKEVEDSTTEITIKKKPKKVPKKEE
TVEEAVIISPATQIEAKPGEVEADELTIRKVVEIPGETFTAQPEKDVEETKPESEEAAVS
LRRPSKKPEEEEDFKAEFKIRKPSLPVEATIIDKPKEVEDSTTEITIKKKPKKVPKKEET
VEEAVIISPATQIEAKPGEVEADELTIRKVVEIPGETFTAQPEKDIEETKPEESIVKLRR
PSKSKPEDVSASQFTLRRPSDSEIPEKEKTVQDVSTEIKIKKKIKKPKEKEVTSEETSVM
LPSISQEITKPQEESSAELTIKKPIIDERGDKPEEEEVVNAFKLSAPKSDSEPQEAAFTV
RRPSKVDTVKESEEVSADLSFTLKRPSLTVSIEGELTLPKIQPIVTSPVEDSFELTLAPK
PRAKTTTEEMTEADTIVLPSTEEPVVYKVSEETAEITIKKQVSEEEYDLLKSKDEKTMKP
PLRRKESIKITKEKPKEDTEESVVSLRRKKSDDKPVEAEFSLKKESPKETSPVEESFTIP
PKPKPRRKSSTQLELVKETVSLETPDSASTVYSVQEESDSITIKKEVSEEEYEKHLKETK
DKEDDKSAKFKLPRKKSDDKPVEAEFSLKKDEPRETSPVSAEFTTHTKPRRKSSTSSVEI
SQTIKSDKIKQEETATDYKISEESVEATIKKPVIIQEEDEETEFKFRRRRSEEKPVESEF
TLKQKQPSPQSGSPVEESFTLPGKTKKVKKVSSVEADAESEKVILPTRKESVDYKITEEQ
AEMTLKKVVSQEEYDQSIGKKKQSDEDDEASFKLRRKKSEDSTVEADYSLRRDSVKSTSS
VDEEFTIKGSRKSSKKSSSIDSTSRTESVESVIRRESVDDDRRKYRIEEEEDQLTIRKEV
SEEEYERLTKSKRRDSKTEYRFGLRRKSSTTGESTVEGKFSVKRDDSIERTKHIGETVEE
SFDLPTSSRTTKKRSKRITEDSSESESIKLPNKIEQAEYKVTEESSEATVRLVASESYIA
ESPDALTIMEGEKVYLIERYSTDWWFVRKHLTKEEGLVPAHILTNIAEFTHNINEKLSEK
IQRLPTFGKTGKPEELEAPTFIKKIESGTCSEGQSYTFQCQISGTPRPTVTWFKHTSFIK
SSEDIEIIYEEDICKLIIKETYLEDSGTYTVVAKNPAGFATCSADLFIEETDISTTISRQ
SMSRESSICNSLSLDGIIPFFTEPLRSRTAPQGSTVTMECSLAAEPKPSISLRFNKETVK
SSRVIIETSEELSLYRITITFKSIELSESGSYELIASNERGVAKTSFNLTVIADSSYGPV
LIEKFSDCSVPEGEPLKLTIKTLKTKGKAKVSWYRNGKKLKETRTIRMVEDTINYQYTLI
IEKTSCDKDNTEFKVIVEDDNGSVEHKAKVTITSGKLYFVEKLVEFDVKERDEALFVVKL
SQENGSVHWEKDGNLIAESTNKYSFICDSYYRKLLIKDAHIADEGEYSCVLENGDRCSAD
LVVIELPPEITERLEDLTVLKGEKIELTIGLTKGDAWVRWYKDDTEISFNSRVRLEIDGK
KQKFIIAKSRLTDAGTYSCTVGEQSSSCVVTVEETSDGGDQSRSETTHTVTFDEEPTFRY
FERADGEKDDQTSQTFSTTSQTSSWMREAGVDPVVRSYIRHKLMGRNEYFFKIWHYPKKE
SRSK
NT seq 36915 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgacatgggctttatttgtgaatgtggcagcctttttatcaaagaaaaggatg
gaaaagcggagaaagattgaaccctttcaatcttccttgacccatggcggtaatcaaaga
caaatgacatcaatgtcaacctcatctcggacatttacaataaaatcaacatcacaaagg
tattcaagtgatagcccaatggacaaagagggctttgatgttgaacaatttgaaaatgga
cttttgaataactcttcgtttcgagaaactttaattagctcaattaataatgatgaaaga
tctcagtggaacaaggaaaatgaacccgattcatttagtcgatcccatgagcagcctaga
atggctcctaaattaattagtaaacttaaaaatggtataattttggaaggatctgatgtt
acattccaagtgaagttaactggtaatccaaaaccattagtttactggttcaagaatggt
ttaccattggtttcttcatcaaggattaattgctggcagcaaaaagttgatcaaggtatt
aatggaaatacaatagttaccattttacacattcatatggcattaccagaagattcgggt
tattatacattgctgattgaaaatgatttgggtcgtttaacgacttcttcacatttaatt
attgaaccaatggatgagacaatcaggttgaaatatttcacatcgaatcaatcaaatcaa
caagaaacagtcaaccgttcccaactatcggcatcagaagatcaatcgcattcactattg
catcaagggttacaacctcattttactcgaataccaaatgatagtcaagttgctgaaggt
aaactgattcgttttgattgtcgagtttctggtcgcccaagtccagaggttttttggtac
cacaatggctctttgattttagatgatggtcgttataagattgttgtcaatgaagatggt
ttaaattcactaatgatacaatcggttgaaaaaagtgattcaggtcgctatatgtgtgtt
tgtcgtaacatccacggacaagaagcttttgaagttaatttaactgttattgaaagacaa
tcctgtgtaccacctaaatttattgaaagatttaccgttcaatatcatcaaccaggcgat
aatttagttttacattgtcgttcattgggcacacctcagcccacattaacttggctcaaa
gatgctcaccaaatttatcccaatcctccaagagttgtaattgaaacacatggaggaaca
tcaacattaatcattcatggagttacaccttcagacgatggttggtatcaatgtactgct
caaaatccatctggaagtacagcaactcgagctcgggttcatgtctttaggggctcagaa
tattctccagttggtcgatcaccaactccagattcattgacaggaagacgaacaccaaat
cgaccagaatcaagacaatcatatcatcatcattcccatcattctcaagtaacatcaaca
tcaatgagaagtgttgactattattatcaacaagaaccaattagtgaaactattcaactt
cgtcacgtaacacgaccagctccaatccgtcgtttagattcggaagaaccatggactcga
acaaatcagatccctccttcatttacatgccacttgcgagatctaacactaatcgaagga
gatagagcatattttgatgctcgcttagttccaattggtgatccttcaattgtcgttgaa
tggacacgtgatggtaggccattagaggactcatcaagaatcatgacaacttataatttt
ggacacgttaccctaacaattttgcgcaccaaaaaatctgatgcaggtgtgtattgctgt
cgagcttggaacagtctgggcgaaacaacaacgacagcagcacttaatgttttcgataaa
caaacaattcaacaaaaatcattattttcatcttcggccaatatcttacaatcttccgat
ttccctgcctcttcacttgttgaagcaccaacaactccaccaacttttataaaaccattg
attgatttaggtaaactttatgagaatggatatgctcatttcgaagctcaaatatctcct
tttgatgatccacatttaacagttaaatggttcttcaatggtaaacctttaacagtcggt
tcacgaattagtactatttacaactttggatatgtcgcactcaacatttcataccttcga
gttgaagattctggtgattatacttgtaaggtagtaaaccgactaggcgaagctgtttca
acagctcggttaaaggtcgtcagcagtgaatctttgcctctcacattcaccgatgaacca
aaaacagcattcttaaccggtgatcaagttaacaaacgtcgctatcaatggtgtatttca
gaagaggaaggacctaaaactgagcccagatttgttgaaaaattgtctgatgtaaaaggc
atacatgttggaagaacagttcattttgaagctactttagagccacagggtgatccaaca
atgaaagttgattggtataaggacgaaaaattgttggaagcatcttcaaggatcaagact
ttcttcaattttggttacgttgcattgactattgaacggacagaagagcgtgatgttgga
cagtataaatgtgtagccatcaataaacgaggctctgatagtacaagtgctattttacag
tttattgaacaagatcatcctgattatcaaccttctccagtccaaccaataagacaaacc
aaagaaacctgggaacggtacagagaaacagaagatattactcgttacaataggattgaa
gtagaagaaattgaattacagcgtaaaccttcatttacttcaccattgattggacctgag
actgttgttgaaggtgaagatgtccaccttgaaacacgctatagccctaagagctcaaac
atttcgttgatctggcttcataatggttcaccaatagacatgaatgatcgccgattttca
gctatatcacactttggttatgctgctcttgatataaggccaacaaaatcaaatgattca
ggtgtgtttactgttattgccaccaacgaaaaaggtgaacaagctgaagtcgctagaagt
attttagtgacaccatcaccatcaacatccttgacctatgaagctggagttgagagaaga
caaactaaattatcatcgtcaagctcacaatcacacattgcattgtctcgatcatcaagc
actattcaagttaaaccctattttattcagccattgactcaaccaactgttcatctaatt
gaaaatcaacatgtccatttggaggctcaagttgagcctgctcatgatgtcgagcttcaa
gttacttggcttaggaatggtcgacaattaccggctaatccaagatacacgacaagggtt
gatgttggtttcattacactcgatatcgttgatcttaaaccagaagacattggtgaatac
acagtgattgttaccaactctttaggctctgcgagttcaagtgcttcccttaaaatgcag
ggctacacaccaaaaactccagaaacttatggaaaagattttaatccattcaaatctcaa
tttgaaaaggatgttcaacaaaggtatcaatcgagagttgatactgaacttgcagctagt
aagcgtgataaggaaagtaaacctaaattcattgttccacctccttcttatacggtcgat
gaaggacaatcattaacattggaaacgcactttatcggcaatccaacaccaacaattaaa
tggtttattgaaaaacgccaaattacttctgatggtattaaatataaaataacaaatgat
acagacgcaggagtttcacgtcttgaaattttcaagaccacatcaaatgattcgggtaga
tacacctgtgaagccacgaataagtacggaacgaatacaacttcatctttaatcgatgtt
tataaaagtggtgagaggcctcgtttccaatcagaactaacagttttaaccattcgacct
ggtcaaccgttggaattgaaatgtcgagtggctggttttccatcgccgatgatagactgg
tttcacaattctattcctattcatcaatcagaagtaacttcaatgacttacaactcagaa
actggagacgcttcattaaccattcataatgtaaccacagaacattcaggtcgttattca
tgtcgagcaactaaccaatatggagttgaagaatcatcgacaattgtaaatgttttacct
gaccttccatatgattcatcatcttctagacccactttctatcgacctctgggtcccatg
gtaattcctctcggtcatccagctaggattattgttgaatatgaagtgaaacaaccattt
caagcaagatggtatcataatggcattgaaattacttcaacggataatattcgtattgag
acaacatcaaatacatcatctttaactatttatcgtgttggtcctgaacatgttggacct
tacagagtaacaatctcctccataagtggtgaagcaacaactttaggagatttgtcaatc
atcgaatcagtccctgattcaagtaaaaggtctgttgagttcaaatctatactgtcgagt
cagcagcagcaacagcaacagcaacagtttacaacgatccagagtcattcaacgaagcaa
tttttatcttacaaatcggcgaaaagtaatattcatcagatcggagatacgtctagtcgt
acatctagcgtaccaccgggtctagatcgaaatcgacttccatctgctccattaggctcc
gaccggttggatagaggaagccaaccattatatggctcggatgccattgattctagatta
ttatcacaagcaacaatctctctagatgagcttcgtggtgatggtctatcaacaacaccg
caacagatgacgaccttgccgttagataacaggcaacgcttacaacgacagcctgtaacc
ctaacgtccaagacggtaacccatccatcatggcctgaacaagcatcatcaaccgaatcc
atttctcgctcacaaatgtatcgggttactcgagtttcatcagcatcacctgaacgcaaa
tcagtttcccctcatttccctcatcacagaccaaaaatgcctgtcaatacagttgaggat
agaataagttcgccaagtggattacctaaagctccaatcaaacatgttgccaatcttgaa
tggaaacctcagcgccttgttttcccagtctctcagatgctggaggatgaaccaaccatg
tttatcagcaaggattcagcaactcttaaaccaacggacaaggtaagtgttagtccttca
attaaacctgtattttcttctattccagtcgacgaaaagagtgaagttaaattaacaatt
gaatcgacgaagaagagttactgggaaacatcgacaactcggaaaacaacaacagtaatg
atggctacggaatcagacaagcgaccagagggcgaacaaagtggatctcaaaaagtcgtc
cagagaatggaaaaagttacccttgaattaaagcctccgatagtcaactttctttttgaa
gaatggaaatctgatgatgaatctggacggaatgagatttattatgatactagaggatat
tcatttccacagaaacaaccaagtttacaaccgacatcgacttcaatcatttatcagcct
tatcaaaaggcaacattggaattgccttgtccacgtctaacctttacatttgatgacttt
gctccaaccaatttaattgctccttcacctgaactgattgatctttcagcatatttgtat
caagaagatgaaactcccaaatcattggagcctttgttttcagttgaatttgaaatacct
tgtccaatgatttactatggtacagctccagctggatcagaaagtgtttcactctcacca
attggcattgaaacaatttcaggcgaaataatcagacctgattcagtaatgtctgaaaga
tctgatgatgttgacatgattgaagatcgtcctagaggcttaaaaagaagtgccagttta
catattactcgagtggttgaaccatctgcagttgtttacacagttccgtgtcctatttat
gagtatcgattccaggaggttccaatcgacaaacatggtcgacctttgtcaggcatattt
gatctgagtgcagctccaccatctcctggcatattgaagagtgaaagtggagtgattgac
gttgaggctctgtatgctcttggttatcttaaaaatttgattgccaccattgaaattccc
aatactcgaataacctttaggattcaaggtaaagcacctaaaccactttcagtgagtgct
ggacttgcagatggtcaaacatcagatcaaccagaagagttgttggttataacagaatat
gaagttcccttccaaagattggaaaccaaaagaccagaaggattgttatctcaaccatca
acgaccggactcggttctcctttacaaccaactactcagactagattaaaagagcaacca
atgacctctgaaacctcacttcctttcccgaaaattttcatgtctctgcatgaagacatg
atgccttctcaaagcactgatgaggcaaatcctcaagtgatcagcatttctcaacaatac
tcaactcaacttaaccgctatgaaacacttgctctaattgaacgtcaatatggccctcta
ccgatgacatccgcgcaaacacaacccgttagcccatcaactgtacgagaagagtttaga
gaggtaaccataagatcgcaaggaaaaagaagatcatctaaaacgatgaaaactgaaagt
aaaactttattgaaagaaaaagataaacccattaaagaaaagaaatcgccaccgaaagag
gaaaactggacatggactggattgactattcctgtgttaacttatgtttttaatttccca
ataccttatatagccaattattttgttccatgttcaaaactcgaaccttctgaggaagtt
tcttctcagttttacataacaatttctgaaaaaattcaaaaaattatttctattgatcaa
cttaaaccaactagtacagtttctgagtcatcatctggtttgagagtcacagattatcct
ttacccgtcgatgttgttcgagacttcattgtaagtgaaggtttcattgaattgacagta
acacaatcggagattgaacttttgaagcgtcaaaggccaccatatgtcagagatactgta
ccaccaatgctgattactatcagaagtcaggccaggcccaaacaaattaaacaatcggtc
aaaagatcagaggttataacgataaaaacatcatcaaagcaaacaggaattgttgatgta
aaacaacaaccaattacacaaagtattgaagttgaatcaacagctaagccaacttttgaa
gctgaaagagtaaggtacgagactattcaaccctcagttcagattgtccattcagttcca
gaatctgaccatgtgagccaacctcaagaaactatgcaaacagaaatttcatcaaaatca
acaccttataatcaaatagtttatcaagttgatttgcccaaagatcaatccctaactact
caccagagttatgaaagtagtcaaatgattcacaaagttgaaaaggttacaccaactcca
atctacataagtcatccagagatgattcagcaacctgaaagtagacagcaaacatcttta
gatatgacaccgaaacaagttcaaccaacaacaactcacattcaacaatctccaccagtc
gcaccgaagcctatccacagacagcctttaggtactccaattgaactgacgattggtaaa
aagactagtcagttcaaacagccagctgaatctaaacttgaaattacaactcaatctaca
gagattccagttaatgaacttgttgatgtaacccagagacctgattatcaacaaaacatt
aatctagaatcgtatggtcgtccatatgaaagaactgaccttaatcggtctattttccaa
tcagtaactaaaacaacaacaattgaaacaagtcctgtagtaactattgatcgaccagca
agcgtgttgcctattacccagactacatcgactcgtttttcagagcaaatggaaagagaa
ccaactaaagttacaactgaaactttacagactcacacagcatcttatcaattaccatcg
cctcaattatattatccgtaccaagatgatagtcaagttcaaatgcctttccagcctcaa
agtcaaactccactggctcctgttagatccaaagtcaagcaagtccctcagcctttgcaa
tcaaaacttgttgtacaacagccagtcgagcgtcaaggtgattcgggtgaagctaaagca
cagccagtaaaaccgatggtaacttcattcgagacgccaacaccaaggataacctatccg
ttccagactgactctgagcgaccagagcaatttattacaggaatgactccacatccaggc
tatattggatacccagatcaagaaaaattcatacctgaagtagcgttagcatcaacttca
agagaaatgacgattcaaacccaatcaaaaacattgactcaactgcaaaaacagccaact
gctggttcatctattatagtaacaaaaatgtcgacacaaaagaggattgaatcaacaaga
gcagtttcacaacctcaaatctcatcttcttctgaagaatttgttgatataaaagttatc
gactcacaaaaacgtcctttcgatgtttcctccaaagctttgcctcaacattttactgaa
tcaataactaaaacaaaagatactcaaccaacaccgaaatccgttatttacaaggaagat
gaaaaacaacatgctcgtgaaacagtttctgcggcaatcgaatcaactatgagagcagaa
aaaatgattccctattcaattgttagatatcatgttcctgatgaaagccaaatgcaacaa
cctgaaatgcctcgagatgtacatattacatcaaaaggtagatcacaaagtaaaatagtt
atggaatcaacaaaggttgaaatcacaaaatctccaatacaacctaagactgccttgatg
gatcaatcagcacctgaaaccagtccattcaaggcatcaacaacttcgttacaaatgtct
aaggagccaactccaactcagaaacctatcgatcaaccagcttttatgccacgtgaagta
acaatcaagtcatctggaaagagtaggtcagaaagtcaattggaaaaatcatcaatatct
cagacaatatcgaaacaagttcaacaccgatttctatctgattcggaattgccttctttt
gattctgctagccagataacttttgataatcaacagcttgcacaggctcaatctgattta
gttcaacaaccaacattattcgaaagtcaaaaattgtatacaagctcacagagatcattt
gaaactcgtgttgatcaaccatatcaacgtgtcgaatatcgtccaccttccgaacttcaa
cctcaaattgtaccgaaaattgatgagggaattcagaaaacagctgcatctcaatatatc
caacacgttttagctccattggttaaagctgaattaacattaccccatccaatgtacata
tttaatgttgaagaaataattgtgagaacaaaagaaacagaaaaaccagcgatagatgaa
acaaaatcaactttaatgacattaacacaacaaagaaaacaaaaggctgttgacacaatt
acaaaggcattaagtcctttcattgtctcattggaaataccatcacctcgatgggtattt
tatattaaagagatacgagtcagaacttcgtccaaagaaagagatcaaatatttatctct
gagattgtcactccatatcacgagattcctgcggtttcccctgcttatgttgaaatgcca
ccagcgcattcatctacctatgagtcacaagctcaacaaactttattgttgactgatttc
aaaggcccagaatcaagagaaacggtcacatttactgaccaacaatcaaccacaccagca
atggcttcattcatagacatacaagaaactgagtctgaaagaagacgtcgagcagctgcg
acaattcattctgtgataagtccattgatcagaactgaatctttcccggttcctagttat
ccaattgagccagttagccaagagttcagattaacatccaagggaaggacgaaagttgat
caaagattcgaaagaagttcacttgaggtgactaaaagtgtacaatctacttcttacgaa
actgctagtcgagatattccttcattggtttcaatcgatcaaatggtagttgaccaacaa
actcgtttacagacttcggttcatcaaattgaatcgacttcatcgccattattacacaca
gaggtcagattaccacagcagtttgttgaagatcagtcgattcgcgaagtaagaataaca
agtaaaggccaaaagacgagtgaggctagattggaaagaactgttatctcggcagaatca
aagccagtagcacaactgttaccagaaagagctgagctaccagataaaccttcagatgac
aaagacgtagctcgaagttatttgcaaaatatcttacaacctcttgtacaaatggaaata
ccttatccccgattgttattccctgtccctgctgacttagaatcggtacaagaaatgact
ataacttcaagaggaagggacagacaagaagcacatttagagacattcgaagctacaaaa
ttagtatcaacaatggattttgaaaaccaacctgaaacagattcaacaacaaaaacaatc
attcaattgaaaagaactgaaaaacataagaaagagaaaaagataattcaaaaacaagta
actgaatcggttgaggggcaaaagccacttcaattcccgacaagagatgttaccataaaa
tcaaaaggaagagaaagatcattaactagactggaatcaactgagattgaagtagaaaca
aaacccaaatcaattgaaatagaaacagttgatcaaccaagttcagttgacactaaagtc
ttagagccatcagatacaaaaacttctcaaacgattcaattgagcaaacctgaaaaaata
caaaggccaattcaagtgaaaactaacataatcgagcaaccatctatgccggttgaatat
ccactgcgcgattttacgataaaatcaaaaggcagagaacgatcattgactagacttgaa
tcagtggagatggagatagaaataaataaaaaggtcgaacaaccaattattgatgaaact
cagataattccggacacggctgagattcctgatgcagattcgaaagatgaagcattaatt
gaagctcaaacagttatccaactgaaaaaaccgactaggagagagatggttgaaaagatc
gaagattcaccaggcccaaaatcgccttcagtacgcgatgttaccattaaatctaagggt
cgggaaaaatctttattacgagtggagtcagttgaggtcgagcttgataaaaagaaagaa
cctaatttgccaattgaaataaagccattaaaggaaacagaagatactagaaaagatact
aaagagatacaattgagtaaacctgtgataattaaaaagaaaattcctggtgaaacagta
attttctatgtacctgaaatcacacgtaaaccatcattaattgaagaaccaatttcatca
acaatgaagattgaaaagacaacaatagagattgaaaaacgcaaaaaaatcgagcagcct
gaacaagttgaactttcaactgaaacaataatgataacttcagaagcaaaagaaattgtt
gattctggtaaaccattggaaactgatgaacatttagttttacctaaaaagcaagaagta
tcagctaagccaagtatcgtaacacaagaagcaatagtaattgctgaaggtactattgat
ggatcaactaaatcattagaaacaaaaattccacaagaaaaagctagtgtcgatttgacg
caatcaaaagcagttacaattgatgaaactggaccagtagagaaagaaacagctttgaaa
gcaccaatacatcctaaatctaaacatgctagagtcttaaaaggtgtaccgaaacaaaga
tctttatcaattgaaggtaaacagttgatggaaactgagttgcctttaacggttgatcaa
ccagagactagtcatttgattccagttaaaactgaccaaactccgatagcaagtgcccaa
gtatctgaagctaaacttgaagaaaaaacgcttcccatagaaacagttgatacaaaagtg
agacgggcttcaatcaagacaacagttccaaaacggagatcagtatctattgaaaggaaa
gatttaatggagaaagagttacttcgaaaagtacctgaaatatcgatatgtaaagcttca
attgacttggtcccgccaattttagcttttcaagttacagtgcaatcgataatggaaact
gaacaaccaatttcagtttcacctgaaaccacggaacatcatgcaaccagctcattcgat
acatcaaaagcagtaactgtcagtgatgttttcgcaccacaagaagttgttgctttcaaa
attccttcaacaaagtcagagtcagcatcagttgaggttacctcatttactgctcctgag
tctcgagttgagttcccatgtgagattgaacagcctcaaaccccagagaaacctaaaaca
tcaaaggtcaaagtaaaagcgccagttaaaacaaagcattcattgatcgttcaacagaaa
gattcctttgaaaaagaatcagaactacaacctgaagtcgttccagataaaggacaagga
tctgtgtctttgacatcaacatctgccatatcagtttcaactcgcgactatttagaagca
gccgagaaacctcttgagatcgattcaatcaaacctaaggttgccacacagtcagtggtt
gacaaaacatcggcagcattatcaatatctaccattgaaactggtgaaagtgagacagtt
cagttatctaagacacctttagataaacgtccaagtgtcagtttgactgaaagtcaagcc
attgaggtaacaacatcaattcctggagatactgagaaaaatctcgaagaaaaagctaaa
ccagagaaacataaattgaagaaaaaagttgatattaaaaaacaaaaacccatttcaatt
gaatctcagcatccaatagaatcagttggatcgattgataaaatggatcaaccccttgaa
caagttaaagagtcaatttcaccaattactcctttaacagttagtaagacggaaactgtt
gaagaatcagaaaaattttctcaacctcaaacagctaagctttcacaagcagctcaatca
atgacgcctttaactcaagctataacagtgcaaagtatagatacaataaactttgaaagt
ccattaaaggttgaccagcctattgtggaagtagctcgcatcgaaataccaacttcaatt
gcaattgaagcttcacttgattcattaattgaagccggacctgaagagacaaaatcagtt
cagccaaaaagccaaaaggttaaacctagaaaattaatcaaaccaaaacatcctcttcaa
gttactcagggtgaatcattcgaacgtgaattagatttaccattggacaacacaatggta
caaacaatttcaagctctattgaaataacaactcgaacagcattttcagtatcttcgagt
gatttaatagaagaagcaactgtttcgacagccttagatactgttaccagtgtggttgaa
gaatcaaaaacaattgaaacgaaacataaaccaataacagtttcatcgattgagactctt
gaaacaaccgattcaatttcagatgtaagaccatcagcaagtcaaccaacggttgatatt
actcaagcacaagctttgtctgtagttgaatcaataacaggtgaaaccgaacagctatat
gcccagccaattactatggaggctaagcgcatgagatccaaaattgatttacaagaaaag
cgaaccttgtccattgaagctccggaattagttgagaatgtagttgaagctgttacagaa
tcaaaaccaagtgacgtcgcaaaacagagtctgattccagaaaaatctgtaaccattgat
ttagtgcaatcgatggagaaagtcgaaactttgaccactacaagcccacaaattaaaact
attgtgtcggttttgtccgataaaattaatacaccaatgacaataacaatggaagtacca
aatgataatgaaaaaccgttaataacacaagaaatgaagccagataaaggagttatgaac
gtcgaaacatcaattgcaattcaagcaactgaagctacatttagtatgaaagaaacagat
tttattgagcagaaaccagtctcggcgtcagctacagcaaaacaaattgaagacgataaa
aaatcaatttcgatagaaagtaaagaaactttggaaaaagaaggcgaattgtcagtacca
acatctaaggaggaaaacttgacaatatcaagttcggtaataactcaacaagcaatggaa
ataactgttgctattcctggtgaaatggaagaaactactaaaccagaaaaaccagaaagg
aaaaaagttacaaaaaagacaaatcttagaaaattaaaatcagtttcaattgagaaacca
gaactttctgaaagtattgttccaatagaaacaacacaacaaccaactaatcaagcagct
aaatcaattgaatcagatcaatcaattattgtttcagataatcaaataattgaacaacca
acagaattgaatattgaatatcctgatgctaagcaaagttcatcaacattaactgataga
aatttacatcatttggaggtttcactccaagatattggagttaaagaaagtgaattggct
ttagataaacctgatgaaagtaatgctgatatcaatatttcaccatcaactgctatgatt
ggtactcaagtgattagtaatgagaaagaaattacaattgaagttggtgttgaagctaag
ccatcaatacaactagaatttgaagctgaaatgagaaaatttaaatcaatttcaatcgag
aaaagagaaacattagaaatggaaggaaaattcgagacacccttgcctcgaaaagagaag
ttatcaaagaaaacttcgatttccaagaaaagatcagtttctattgaaagaccattagtt
atggaaagtgaatcttcaactgatatacaaattcaacctgaaatgaaactaaaagaaagt
aaagttgattcaaaatcatcatttgcaacaacaaacatacaacaagaaagtcttgaaagt
gaatcacaattagatcaaccaatagtgaaatcaagtcaagctgataaattgattgaatca
ataccacaagctttaactgttataacaagtgatgtttcacaagatgaaatacctttagat
ttaccaaaagagacaagttcatctgcatcaattgatataccaacaatgattgttgctgaa
tcacgagttgatcaagtaatagagaaagaagatatttcaacaattgatgaaaatatttca
aaaccagaaaaaaagaaagtaaaagtgaaaccaacaatacgatcaaaacaatcattcgaa
gttatccaaaaggattcgttcgaaaaagaaagtccaattgaaactgataaaacagaagtc
gctacacaaaagtttgaagaaacaggaaaaacagtagcaacagttgaatcaaaacaattg
atggaaactgaaactgaaagtttcatctcacctgatcaaagtgaatatgttattccaaag
cttactgaagagctcaataggacaatcactatccaggattcacaacccattgaattggag
gagtcagttatttctcaaaagttaccaactgtccaacctcaagttgcttttgccacaagc
caaggaattacaatcactgcacaaattcctggtgaaacagaaacgattctaccagaagaa
ttaaaacctgaatctcataaacttaagaaaaaagtagatctgaaaaaacaaagatctctg
tctgttgaacgtccagttacgatggaagcgactgaaaacatcccgatctcggaaaacaaa
aaagagacggcgagtcagttattatcacctgaagcatctttagtagtgtcaacgatagaa
tcagttgaaaacacagtcaagctagaaatagaaataccttcagagaaaacagttgtgaag
tcaatatcagagtccgtctatcattcttatgaggtgaacatacctgttgccgatttagcc
gagactgatttgaaacagatccctcatacctcatcgaaagctcagattggaataacagaa
tcagaagctgcttctggaataattagtcaaccagttgaatctgaagttacattagatgtc
gattctttgcctgaaaaagtgaaaccaacaaaaacattaacaaagaaaaaatcaagatca
atttcaattgaaagaaaacaaagttatgagaaagaagacaaactcgatgttgagttatgt
aaaccagaaagtgctaagcctgatattagtgatactcaagcaatatcaattggaattgat
gttccgattgaaaaagaagaacaattaaaagaagatgttaaaccagagaagaaaaaggtt
aaagcaaagagacctttgagtaaaacaagatcagcatcaattgaaagaccacaattaatg
gacaaagaagatgaatttgatgtgaaaaagccgttggtcgttacagcaacaacatcaatg
gttcctcaaaagacgatcgaaagttcaacagtcgatacattggaaagtgaacaagttgta
ataccaatagatgaaagtcaaattgctgagaaaacggcaaaaatatcaacagaaacaaaa
ttattagagaaagtaaaatcatctgaaaaactgttgacaatgattggtgaacctgaaatt
gaaagaccgaaaattgaacaagaaattgaaattgaatcaaaaggacgtaaaccaattcgt
aaagaaataattcaaacgtttaaaaaagttggtgataaaataacttccattcaagttgaa
tcaactcaatatgaagattccattgttgatattactatggaacaagatagtaaacaagaa
attgatattgaatctaaaaagaaaggtgatttattcgttgaagaattaacaactgaattt
ggtgaatcaccaactccaacaacaaccaaaatggaagattctatcagtattgaattacct
gaggaagaccaagaagtaatatcaaaagagaaagataaatcatctgaatcaatcgagata
atgcctgatatggatattaaagttgaatctaaaggaaagaaagacaaaaagaaacctaaa
ttcagtgaaaggtttggtgtacatcgcaacgtagctgatattcaagttgaaggtaagtcg
gacattgataatattcctgtagatagttcctctgaaaatttagaacaaatagattccttg
gaaaatgtccctgttgttgaaatggaaatgattaaagatgaaatatcggatttgattggt
gaagctccggaagatactaaaccagttgacgaggatgaacaagataaaagtgaaattaaa
gttaaaactcataaagctaagttaaagattcctggaactcgagttatctacaaagttcct
ggtcatcgtgccagatcacccagaattgatacattcgagtcacccgaaattcctggttat
caagtagttaaacttagcattccaggtaaacgagttatcttccgagcaagaccaaaagga
ggcaaacatagtgaccaagaagaggagattgtaccggaaaagaagagtggattaactatg
gatttaaagatggaccagattgaacaaaaggaagagaaaggtgatttggttggagtggaa
gagagtgagaagagtcaaagagtgacaattagatcaaaaggaagaatgaaatcattgcaa
agacatgaagcagttgatcttgagattgatattgataatcaagaacattatgagacattc
gagatgattggtgatgaagttcagccagaggttatccaagaagatgaaaaaatagtgacc
acaaaattgaaaataactggacgtaaaatcgtattcaaagtaccaagaagaatgagtcag
cctgagattgaaagtgaaatggttattgatcaacctgctcaaatcgaaattccagatatt
attgaagctcaaactacgatcgaactcaagaaacctgatcaaaaaccagttgaagttgtg
aaacaaagtgaatccgttgaacttgaaaaatcaatcccagttcaagaagtcaccataaaa
tcaagaggtcaacagaaaatggaaactcagctagaatctgaatctatagaaattgaaaaa
gcaccaaaaccaagtttacaagagacagagtccgaagatctaaggcctgttgaaacatca
gttgaactacagataaaagaaaaagaaactgaatcagagatggttgagaaagataaacaa
actgaaacgacgaaagtaaaaatttctggtcgtaaagttgttttcagagttccttctaaa
tctgaagaaggtgaaactgtcgagaaattgtctgaaatcgaaacatcaatcgatcaacct
gaagagcagcctaaaaaagtagaaacacaaatgaaacctaaaaggccaagcattggatca
atgcaagaaattattattgcagcaaaaggacgacaaaaatcatcttcaatattggaatct
actcagattgaagctgaacaagtgatgactgaagaagatatcgaagaatctgttaaaatt
aatattactggtaaaaggattgtcttcagagttccaagaaaattatgtttggaagacgcg
actgtttctgaggaattagagcaaccaaaagacatcgaggaacaagaaatagcagaaata
accgatgatgttcccgcaacggatgaaatgagtagcattgatattaagggtaaaagaatt
gtattcaaagtgcctagaaggttcagcaaagaacagataatggaagctgaagagtcaatt
tcagaaacaacacaagtgaaaataactggacgcaaaattgtttttaaagttcctcgaaga
ctcagccaacctgaaactgaagagttgcaaataagtcatgatgaggctgatatttcagtg
agtgaacaggttgaagttgatacacaattcaacgcgaaggaagacatagagttacagttg
gaaaaagaaaaggtacgagaagatcttgagatggaaactcagcctgattctgttcaagaa
ataagtattacatctaaaggacaagagaaatcagatctcgaaatagtctcagaacaaatt
gaagttgtaaaagaaataactgaaacaacaactcctgatggcgttacagatgcgacagta
ccagataaaataaagaaaacaaagaaaaagattaaattcgaagaaaaacctgcagaagat
tacaaatcgagtgaacaaattgaaatagaaaaagaattagaagaagaagaaataaaaaag
gttgaaattgaaactcaaccagattctgcccaagagataagcataacatctaaagggcag
aagaaatcagaaattaaaatcgaatcagagcaaattgaagcgataaaagaaattactgaa
accacaattcctgatggagtaacagatgcaacaataccggaaagtgataaaactaaagcg
aagaaaaccaagaaaaagatcaagccagagacgaaatctattgatgtgactgaagaagag
tcacgttctgaagctcaagtaacaatagagttgcgacaaaaaatagaagcaactgtagaa
aaggacgaaggagagaagctagaaatcgaaattcaacctgattctgcccaagagataagc
ataacatctaagggacaaaagaaatcggagatcaggatagattcagagcaattggaagtc
acaaaagaaatcacagaaacaacaatacctgatggtgtaacagacgtaacggtaccagaa
agtgacaaagagaagatcaagaaaactaagaaaaaggttaaacccaaagacaaacctgca
gaagaatttaaatcgactgaacaaatcgaaatggaaaaagaaatagaagagaaagaagta
gaaaaggttgaaattgtaactcaaccagattccactcaagaaataagcatcatatctaaa
gggcaaaagaaatcagaaatcaaaatagactcagcagaaatcgaagccgtgaaagaaata
actgaaacaacaatacctgatagcattacagaagctgcagcaccagaaaagatcaagaag
acaaagaaaaaggttaaaccaacagaaaaaccagaagaagattttaaatctagagaacaa
attgacatggaaaaaacaatcgaagaaaaagcaacggaaaaggttgaaattgaaactcaa
cctgattccactcaagaaatgagcataatgtctaaaggaagagataaatcagagctcgac
atcgactctgagaaaatggaaatcaccagagaaatcactgaaacagcaacttctgacgtt
gtgactgatgtaacgataccagaaaaagacagagaaaaagtcacgaaaacaaagaaaaag
attaaacccaaagaaaaacctgctcaagatttcaaatcaagtgaacaaattgagatggac
aaagatcaagatcaagagatttctcaagatgtatccataagttcaaagggtaaagataaa
tcagaaattcttatagaatcagaaaatattgaagttgaacgtgaacctgttctgttgatt
gcacatgtggatgaagaagacaaaccagatttagaaagaaaagattcgattgtaattgaa
tcgggtaaaacagtgatgattaagaagaagattccaggtgaaacagttactttccatgtg
cctgaaatcacacgtaaaccatcattaattgaggaaccaatttcatcaacaatgaaaatt
gaaaagacaacaatagaaattgaaaaacgcaaaaagattgaacaacctgaacaagttgaa
ctttcaactgaaacaataatgataacttcagaagcaaaagaaattgttgattctggcaaa
ccattggaaacggatgaacatttagttttacctaaaaagcaagaagtatcagctaagcca
agtatcgtaacacaagaagcaatagtaattgctgaaggtactatcgatgggtcaactaaa
tcattagaaacaaaaattccacaagaaaaagctagtgttgatttgactcaatcaaaagca
gttacaattgatgaaactggattagtagagaaagaggtggaattaaaatcccccattcaa
ccaaccagtagaagagccaaagttaaaaaggacatcactaaacagagatctttatcaatc
gaaagagctagtgtcatggaaagtgaatcgtctttaccaagtgataaacaagaataccaa
cttgcacaagttgatttgacccttttggacactgcagcacaaacagtttcttcgtcgccc
tttgaatccaccaaattacttactgatcagactgatcaagtttcttctgcagatttacat
attgatgttaactctgcaataacaatcaccagtgccacaacaatacaccaagaaacttgt
ttaccagatattgataaaccagacacaaaatcagcttcagttgatataacacctttaact
gttcctgaaaaaagattagaaatcgatgttatggaaactgaaactccggcatctgatgat
actccagattctcataaaattgtaccaaaggcaccaataagagtaaaacattcattaatt
attaccaaaggacaaccaattgaaacagaaaagacaattgaatcaagttcaattgaaatg
tcatcaactaaagttgaagttactccaagttcatctttattgattactcaaagtcagcct
ttagaaactgaagtcaacattgaaaaaagtgaaagcacaagacaattagcatcaattggt
ttatcagatgaacaaaataaaccattaagtgtttcatcaactgaaattatagaaactgga
tcagatctgaaacccgaaattacaactacagaaaaacctaaaattggttttacagaaagt
cattcaattgaaataacatcaaaaacaattggtgaatctgaaaaagaattggctattcca
gttgcacctgaaagaaagaaaggaactaaaaaagtgaatcttaaaaaacaaagatcagtg
tcgatagaaagacgtcaacttgttgattcagtaacaccaatagttaatgatgaagcacca
agggataaagcaaaggaatcgattctaccgaaaacttctaagtctctttcaatttctaca
gttgaaacaaacgaatctactgagcttgaaaagcctgttgatacacaaatggagagagca
gaacagcaactaacttcttcaacagcatttaccgtaggacttgatgaatctgttgagcga
gaaggtgaacttaagatgccaacgcaagttaaggatcaggtcaccgaaattcatgacgat
cttcctcgcaaaagctcagtgattgtgagcaactatcctttgatggagaaagaaggtaca
gcgataattgaccaattcaataaatcacgtttagagccacaatcaatacaagaagcgata
tcagtgccttcagttagtcagatatcaccttttgagactgaaaagttactatcaaccgaa
attcctgacagcagtgaagcacaggcgagtcttacaatgagcagagaactaaatgtcgag
gacaatgaaattgttcaacaagttctcccattggatatcaatattcgccatcctggagaa
gctttgactgacattccgacaatgatgatagctgaatcccaagtcacaatgcctgctgag
aaggaatcagaaataaaagaaccagaacaagaaactagaaaaataaagccaaagaaacct
ttaaaaccaatgcattctttggaggtgcaaagtgaagagcctttcgagaaagaaactgat
ttggttactaaactaacaactgattctgcatcagaaatgacacaattgacactccgatca
gctttgacggttgccactccaagctcattggaggcatatcaagattcagatattgcagat
gtttgcaagccagaagaagctgaatcagtaaaaactacacaaatagttgaatcgataaac
atcacaacaacacaacctattgagactacaaccgcaacttctgacgaaaagattgactgg
gaagttccaactgtgagtctatccgttagttcagcagcaacaatcactgaaaagatcgct
ggtgaaactgaatcatctttggagaagcagcccattcctgaaacaaaacaagcgacaaca
aaaacaggtgacttgaacaaaagtctgaatattaatgcacagcaacctattgaaacagtt
ggtgccattacatcaacacagcaaactgaacaaaaagtggtttctgatcttgtgcctggt
aaggccattgttatttcgagcaatgaaacgatagaaaatattgtaacattaacaattgag
agtccagcagttcaaacggtttcctcagttttaagtgaatcaattccattggaagtcaca
agtaacgaaatagttcaatctgaagtagaactggaaacaaagactccaaatatacagaaa
ccttcgatgagtgtttcaacatcagaagctattcaggtttcattagaagctcaacttaac
tctgaggtgccacttgaagagcaagaagtgccaagatcagctcaagcaactggcaaagtc
aaagagttggaacaaagatcaatatcaatcgaaaaacgagaaatactagagaaagaaggc
gatttaaaaagcgataaaccgaaactggacaaatctactaagcgtcgcaatttggtgaag
aagcgctcagtctcaatcgaaaggccgcaaatattagaggcatctgttcctttagatact
tcactagacaaaagtattcaaatagagcaaaaagatattcctaaaaaatctgtgatatgt
cctgaagtgagtcaaccatcaactcttgaatttcccaaggcatttgatcaagaaacacca
gataatatgcaaacagcagaaagaaattttgaatcaaatcaagctatacaaatagccagt
cttgatgctttgattgaatcaagtggtattgctccagataatgaaatacccaactcagtt
acaggagtagttgtaacaacaataaatcaagttaatccattgattatagcacaaaaagat
tccttcgaacgtgaaggtgaagttgagtcaattccatcggaaatcgcatccgctactctt
gaaccaacaacccgaacaactgtttcagtagcctcacctgagacattggaagcggctgaa
agagttgaagtctctttagaccattcagcaactgctcagaaaagattaacaactgagtcc
aatcgatcaataactgtgtctcaagtacaaacagttgaaataggatcagttgttgaagag
aaaccattaataccagtgattccaacgatcggtttaactgagaatcaagcagttgaaata
gcatcagcaactcttggggaagtaccggaatcattgaaaacaaagatgcccagagagaaa
cgccttgaaggaaagactactttgagaaaacaaagatctgcttccatcgaacgtcccatt
attgttgaaacagtagctgatgttgaaacaaaacctgaaacattagataaggccaaagag
caattagtaccagaaaactcgattgcaataacaactcatcaaacagttgaaggagtagag
gacatacaagttcaggctgctattatgaccgagtctgatttcacacatgtttctcatcag
gctattgaagtatctgcacaacaattcgttcaatctgaagaacaattatcaacagcttct
cctgaaaaagtaaaagtgaaaccaataataccagaaaatacaaaaacagttcacaaaaca
tatcaaagtcaaccaatggaatgcgaaggcattttggatattgatgaagtgaaaaaagga
aaagttaaatcaacaattgaaagtgttaagcatcgatcagcatcaattgaaagaagacca
acttatgaaaaagaaggcgaaattttgattaagccatcaaatgaagaaacgatagatgca
actattgaacaagctgaagctgtgaaagtttcacaacacgatttgattgagaaagaaagt
gaatatgaaatgcctgatgcaccacaatcaagcaaagtgacgattaaaacgccaattgtt
actcaacaagcaatggaaataactgtttctattcccggtgaaatggaagaaaccactaaa
ccggaaaaaccagaaaggaaaaaagttacaaaaaagacaaatcttagaaaattaaaatca
gtttcaattgagaaaccagaactttctgaaagtattgttccaatagaaacaacacaacaa
ccaactaatcaagcagctaaatcaattgaatctgatcaatcaattattgtttctgataat
caaataattgaacaaccaacagaattgaatattgaatatcctgatgctaagcaaagttca
tcaacattaactgaaagaaatttacatcatttggaggtttcactccaagatattggagtt
aaagaaagtgaattggctttagataaacctgatgaaagtaatgctgatataaatatttca
ccatcaactgctatgattggtactcaagtaattagtaatgagaaagaaattccaattgaa
gttggtgttgaagctaagccatcaatacaaccagaatttgaagctgaaatgagaaaattg
aaatcaatttcaatcgagaaaagagaaacattagaaatggaaggaaaattcgagacacct
ttgcctcgaaaagagaaattatcaaagaaaacttcaatttctaagaaaagatcagtttct
attgaaagaccattagttatggaaagtgaatcttcaactgatatacaaagtcaacctgaa
atgaaactaaaagaaagtaaagttgattcaaaatcatcatttgtaacaacaaacacacaa
caagaaagtcttgaaagtgaatcacaattagatcaaccaataataaaatcaagtcaagct
gataaattgattgaatcaataccacaagctttaactgttataacaagtgatgtttcacaa
gatgaaatacctttagatttaccaaaagagacaagttcatctgcatcaattgatatacca
acaatgattgttgctgaatcacgagttgatcaagtaatagagaaagaagatatttcaaca
attgatgaaaatatttcaaaaccagaaaaaaagaaagtaaaagtgaaaccaacaatacga
tcaaaacaatcatttgaagttatccaaaaagattcattcgaaaaagaaagtccaattgaa
actgataaaacagaagtcgctacacaaaagcttgaagaaactccaaaaacagtagcaaca
attgaatcaaaacaattgttagaatctgaagaatctgtgccaataatggatcaaaaacct
gaatcagcttctgaatcgattccattaataaatcgaatcgcgctttcagtagaaagtgct
aaatctctggatagcacacaaccaattgaaggtgctactagtgatttgaataaagcaacc
atcaaaactgaggaaaagtcaactaagcctgttactatttcaacaactattgcagctgaa
tccgaggcagctttacaaactgagtcgattgatatgcaaaaatcacaagttactgtgaca
gaaactcacgctttaaagataacaacacaggttacaaacgagattgaaggaattttggcc
gaagataaaccaataactcaacgaattaagaagtccgttagtttcaaagaacagaaatcg
ctatcaatagaaaagccaacatcgttggaatcaacgagcaatttagatcattccaaacaa
gacgaagacaaagcaagaaagacaatggacgaagagcaatcattaaatgtaacgttggat
caaccctacgattccatagaaaaattccaaactgaacaatcaccagcaaaaacagcttca
acagaaattgtcgatttgacaaacaaagcgattcaaatttctatacaagaaccagtaatg
tctgaagagaaaatggatacgatcaaatctgaagaatcaatagctgaacttaatttaact
gaatcagaagctgcttctggaataattagtcaaccagttgaatctgaagttacattagat
gtcgattctttgcctgaaaaagtgaaaccaacaaaaacattaacaaagaaaaaatcaaga
tcaatttcaattgaaagaaaacaaagttatgagaaagaagacaaactcgatgttgagtta
tgtaaaccagaaagtgctaagcctgatattagtgatactcaagcaatatcaattggaatt
gatgttccgattgaaaaagaagaacaattaaaagaagatgttaaaccagagaagaaaaag
gttaaagcaaagagacctttgagtaaaacaagatcagcatcaattgaaagaccacaatta
atggacaaagaagatgaatttgatgtgaaaaagccgttggtcgttacagcaacaacatca
atggttcctcaaaagacgactgaaagttcaacagtcgatacattggaaagtgaacaagtt
gcaataccaatagatgaaagtcaaattgctgagaaaacggcaaaaatatcaaccgaagca
aaattattagagaaagtaaaatcatctaaaaaactgttgacaatgattggtgaacctgaa
attgaaagaccaaaaatagaacaagaaattgaaattgaatctaaaggacgtaaaccaatt
cgtaaagaaattattcaaacgtttaaaaaagttggtgataaaataacatccattcaagtt
gaatcaactcaatatgaagattcaattgttgatattactatggaacaagatagcagacaa
gaaattgatattgaatctaaaaagaaaggtgatttattcgttgaagaattaacaactgaa
tttggtgaatcaccaactccaacaacaaccaaaatggaagattctatcagtattgaatta
cctgaggaagaccaagaagtaatatcaaaagagaaagataaatcatctgaatcaatcgag
ataatgcctgatatggatattaaggttgaatctaaaggaaagaaagacaagaaaaagaaa
cctaaattcagtgaaaggtttgaatctgaaagaccaatttctgatattgaaagtcctgaa
gaagtcgtcacattgccaacaaagaaaccaacttcaaagcctgatttcactgaaagattt
gaaattgaccagcctgaagaaaaaatggacaacctcattgcagaaggtatagaatcaatt
gataatgctgaatcaagcttcacaattaaagctcaggaaaaggttcaaggtcctgagtcc
acttctgaggttgatgttgcaaccattgttagcattgatgaaagtccaaaagaaactctg
ccagaatcagacgactctgttttccttgacgttcccgcacctactgatgtgagcgaaatc
actttggaaacaaagccaaaggacagggaagaaactgaagatgaaattgctttcgcacat
gctactagtaaagctaaaagggttcgcttctcgattggtgacgccattttacaacccggc
gagtcaattgacggttcggaaacaatatctattgatatgcctatggaaaccactgttttc
tcagtacctgaagctgaaaaggatgaaaaacctgaagaatcaagtaaagtttcatttaag
ctttctaagcctaagaatgaactagatgaaactgaaacatctgtttctttgaaaaaagaa
gaaccttcaaaaccattagtcgaatcgacagaaactgaacaagctactttcagttttggt
tcaagaaagccgtcagtcgaacaagaagatgttagtgaaacatttacgctccaaagttcg
gagaaaacggtattccaagttcctgatgttgaacaagagacttcagtttccgttgacttt
gttttaccagaacgaaaacaatcattcgttagtccatcaccattcctcgaaagtgttgaa
acggtagttgatgcaccattatttaagaaagaaacgtcgatggagaatcaagttgttact
ttccaagttccaggttatgtagaagaagaaattattgtttctactgaaattgttgtacca
actgaaaagcaaatgtttatcagcccatccgaaattccagttgaaactgaaaagatcgaa
ttaaaggataagaaagaaacaactgaaactgcaattttagaaacttcaagtcaaccaata
catttccaagtccctgatttaccagtagaggcaaatgaagttgttgatttggaaatccct
tgtaaagttcaatcgttcgtccagccaaaagatgaaaagatcgaagaaaaacctattgaa
actagtgtaaagaaaatcaaaaagaaacaagaaactgtcgaatcaacatccattgagaca
actggaaaaccaattgtctttaatgttcctgaaactctaaaagagtctacgcaaattgtg
acagtcgaaatacccgatcgtaaacaatcactgataaaaccagaagtgaatctgtctgag
actgaacaaccaacttcaccgactgaagtgatcgcttccaaagagaaaccaaaagatgag
ataaaaatcgaatcagtcgaattaactattccagagaaagaaactgttttccaagttcct
gaaattactgagcaaacagtgcgatcagatattaatatcccatgtcgtcgtcaatcattt
gtatcaccttcgtctattccaattgaagaatcaaaacgtaaaaaatctgttgcagaaaca
gccaatgaatcaacaaccattgaaacaaccggtaaaccgatagttttcaaggtaccagaa
acaatggatgaaaatgtttccatatctcttgatattcctgggcgaaaacaatctgttgtt
aaaccaactcctcttccagaggaaaaggaagaaacaaaaattgtggaatcacctgagaaa
gtgactgaatctgaagaattaattgtgaaatcagaaaaaccggaagaagatcaagaagaa
acaacaactgtcagctttaagcaaaagaaaccggaacattctgtaccagaagagatctct
gtttctttgaaggcaagaaagccgtccattggtgataaagatactccaatccaggaagac
attgaaacatcgataacagtcaagaaaaaaccaaagaaaaggccatcagatgctgaggct
gtctccatggttagtttgactatgccatgtagagaaacagctttcactattccagcagaa
acatcgattgatattcctaaaagagcatcaataactactgtagatactgttactgaagct
gtaaaacctgaggaaatgcctgaagagaaacaagcagaagaaactatagatacgataaaa
cttagaaaaccgtcaaaagaacaagaatcacctgtagaagtatctattgtacctcaaaaa
gatcatgaaactccagtacatgttgagtcaatcaagttaccgaaaaaggaagaacagaaa
agtcaacctgaggaagtaacttctgttcaactaaaagcgcctatttcagttccagaagaa
gttgagactacttcaataactctgaaaaaatcatcgattcctgataaaccaagcgaggaa
tcacagctgaccagtgagttcaagttgacattaccgacaaaagaagacgcaaatgtacaa
gagatcgagaaaccaatcgtgacaatggaaacatcaatagcaataaagaagaagccaaag
aaaaagaaagaaattgaagccagtagtacatctttaacaatacaaagtaaaccagaagaa
gcaacggtaccagagaaagaggccgctacttcggagctaactttgtcgactgaaaaagta
tccatttcgcctcgcagaacttctttccaatctccagaaaacattccagaaaaacctaca
aaagaaattgttgaacaaattatcaaaccaacagaggaaaacaaagaggagaaacctgaa
gaggataaaaaacctattgaagtggcgatcaaactgcgtaaaccttcagctcctcaagtt
gaagctgaagctgtaatcacaaaacaacgaaaagaacttgaaaatatggacacagaaatt
gtgatcaagaaaaaaccaaagaagaaatctgctgacgcagaaatgacaactattgtaact
aagcctgctattgaagaagttaaggttccttcgttagatgtcgaggctgaattgtccata
gttaaaacagaccaagtttcaatggttggtgaaaaggttgaattttcagcgccagaagaa
tccaaagatcagccggaggtatcttcagtaacaatgcgaaaacctagtaaagattacgag
gaagatctaaaagctgagtttaagattccaaaaccatcatccgttgaaatcgatgtttcg
gaaaagcctaaagaagttgaggattcattgactgaaataacaattaaaaagaaacctaaa
aagacaaagaaagaagtagctgttgaagaagctgttacaatcagtccaactgttacagag
gaaacaaaacctagtgaaatagaagctgacgaactaacaattcgtaaagaggttgaaatt
cctggtgaaatagttacacttaagccagatttagacgagacaacttcagttgaagtgatt
aaacctgaagaaaaacctgatataaaaccagaagaaacggaaacacaagcagaatttaag
attcgtaagccttcattacctgttgaagctactattattgataaacccaaagaagttgag
gattcaacaaccgaaataactatcaagaagaaacccaaaaaggttcctaaaaaggaagag
actgttgaagaagccgtaataataagtccagctactcaaattgaagctaaaccaggtgaa
gttgaagctgatgagttgactattcgtaaagttgtcgaaattccaggtgaaacttttaca
gctcaacctgagaaagacgttgaagaaacaaaacctgaatcagaggaagcagcagtttca
ctccgaagaccgagcaagaaaccagaggaagaggaagatttcaaagcagaattcaagatt
cgtaagccttcgttacctgttgaagctactattattgataaacccaaagaagttgaggat
tcaacaaccgaaataactatcaagaagaaacccaaaaaggttcctaaaaaggaagagact
gttgaagaagccgtaataataagtccagctactcaaattgaagctaaaccaggtgaagtt
gaagctgatgagttgactattcgtaaagttgtcgaaattccaggtgaaacttttacagct
caacctgagaaagacattgaagaaaccaaacctgaagaatcgattgttaaacttcgcagg
ccgtcaaaatctaaacccgaagatgttagcgcatcgcaatttacattaagacgtccaagt
gattctgaaataccagaaaaagagaagactgttcaggatgtttcaacggaaatcaaaatt
aagaaaaaaatcaaaaaaccaaaagaaaaggaagtcacatctgaagagactagtgtgatg
ctaccatcaattagtcaagaaataactaaacctcaggaagaaagctctgcggaacttaca
attaaaaaaccaattattgatgaaagaggcgacaagcctgaagaagaagaggttgttaat
gcgttcaaactatcggcaccaaaatctgatagtgaaccacaagaagctgcatttactgtt
cgtcgaccatcaaaagtagacactgtaaaagaatcagaggaagtgtctgccgatctttca
tttactttgaagagaccttcacttactgtctccattgaaggggaattaacacttcccaag
attcaacctattgttacatctccagtcgaagactcatttgaattaactttagcaccgaag
ccaagggcaaaaacaactacagaagagatgacagaagcagatacaattgtgttaccttca
acggaagaaccagtcgtatataaagtctctgaagagactgctgaaataacaatcaaaaaa
caggtttctgaagaagaatatgatctattgaaatcaaaagatgagaaaaccatgaaacct
cctttgagacgcaaagaaagtattaaaataaccaaagaaaagccaaaagaagatactgaa
gaatcagttgttagtcttcgtcgtaagaagtctgatgataaacctgttgaggctgaattc
agtttaaagaaagaatcgccaaaagaaacttctccagttgaggagagcttcactattcca
ccgaaacccaaacctaggcggaagtcttcaactcaattggaattggtaaaagagacagtt
tctcttgaaacaccagattccgcttctactgtttattctgttcaagaagaatcagattcc
ataacgataaagaaagaagttagtgaagaagaatatgagaaacatttgaaagaaactaaa
gacaaagaagacgacaaatcagctaaatttaaattaccccgtaaaaaatctgatgataaa
ccagttgaagctgagtttagtttgaaaaaagatgaacctcgtgaaacatcgccagtttct
gcagaattcacaactcataccaaacctaggcgtaaaagttcaacaagctctgttgaaata
agtcaaacaattaaatcagataaaattaaacaagaggaaactgccactgattataagata
tcagaggagagtgttgaggctaccattaagaaaccagtcattatccaagaagaggatgaa
gagactgagttcaaatttagacgccgacgatcagaagagaagccagttgaatctgagttt
actcttaaacaaaagcaaccttcacctcaatcaggatcaccggttgaagaaagctttact
ctgccagggaaaaccaagaaggtaaagaaagtatcatcagtagaagctgatgccgaatca
gaaaaggttattttacctacgaggaaagaatctgttgattacaaaatcactgaagaacaa
gcagaaatgacattgaaaaaggttgtttctcaagaggaatacgatcaatctattggtaaa
aagaagcaaagcgatgaagatgatgaggcctcattcaaattgagacgcaagaaatcagaa
gattctactgttgaagctgattattctttacgtcgagactcagtaaagtcaaccagctcg
gttgatgaagaatttactattaaaggatccagaaagtcgtctaagaaatcttcctcaatt
gattcaacctctcgaactgaatccgttgaatctgttattcgacgagaaagtgttgatgat
gacagaaggaaatatcgtattgaagaagaagaagatcaattgacaattcggaaggaggtt
tctgaggaagaatatgaaagattaaccaagagtaagcgacgtgattctaaaactgaatat
cgatttggattaagacgtaaatcaagtaccacaggtgaaagcaccgttgaaggtaaattt
tcggtgaaaagggatgactcaattgaaagaaccaaacatattggtgaaacagttgaggaa
tcatttgatttacctacatcaagtagaacgacaaagaaacgaagtaaacgtataaccgag
gattcaagtgaatcagagtcaattaagttaccaaataaaattgaacaagctgaatataaa
gtaacagaggaatcatctgaagccactgttcgtttggtggcatcagagtcttacatcgct
gaatcaccagatgccttaaccatcatggaaggtgaaaaggtttacctgattgaaagatat
tcaaccgattggtggtttgttagaaaacatttaaccaaagaggaaggtttggttccagct
catatattgactaatatagctgagttcactcacaatattaatgaaaaattgagtgaaaag
atccagagattaccaacttttggaaaaactggcaaaccagaggaattggaagctcctacc
tttattaagaaaattgaatcgggaacatgttcagaagggcaaagttataccttccagtgt
caaatctctggtactcctagaccaacagttacctggttcaagcacacctcgtttataaag
tcttctgaagacattgaaattatttatgaagaagatatctgtaaattaatcatcaaggaa
acttatttagaagattcaggcacttatacagtcgttgctaaaaaccctgctggttttgca
acttgttcagccgatctattcattgaagaaactgatatttcgacaaccatttctcgtcaa
agtatgtcccgtgaatcatccatttgtaattcactcagtttggatggaatcattccattc
tttactgagccattgcgatctcgtacggctccgcaaggatcgacagtaacaatggaatgt
tcattagctgctgagcctaagccatctattagtttacgctttaacaaggagactgttaaa
tcatcaagagtgatcattgaaacatcagaagagcttagcttgtacagaataacaattacc
tttaaaagtattgaactatctgaaagtggatcttatgaattgattgccagcaatgaacgt
ggtgtggccaaaacaagcttcaatttaactgtaatagctgattcaagttatggacctgtt
ctgattgaaaagtttagtgattgttcagtaccagaaggtgaacccttaaagttaaccatc
aaaactctcaaaaccaaaggcaaagcaaaagtctcatggtatagaaatggcaaaaaattg
aaagaaaccagaacaatccgaatggttgaggacacaattaattatcaatatactcttatc
atcgagaaaacaagctgtgataaagataatacagaattcaaagtaattgtggaagatgat
aatggatctgtcgaacataaagcgaaggtgaccattacttcgggaaaattatattttgtc
gagaaattggttgaattcgatgttaaagagcgagatgaagctctatttgtcgtgaagctg
tcccaagaaaacggttccgttcattgggaaaaggatggtaatttgatagctgaaagtacg
aataaatatagtttcatctgtgattcatattatcgtaaattgttgataaaagatgctcat
attgctgacgaaggggaatactcttgcgtgttggaaaatggagatcgttgttcagctgat
ttagttgttattgaacttccacctgaaataactgagcgtctcgaagatttaactgtatta
aaaggagaaaaaattgaactgacaattggattaactaaaggagatgcttgggttcgttgg
tataaagacgatactgaaatttctttcaattctcgtgttcgcctagaaattgatggtaaa
aagcagaaatttattatcgctaaatcaagattaactgatgcaggaacctattcttgcaca
gttggtgaacaatcatcttcctgtgttgtaacagtagaagaaacttctgatggtggagat
cagtcaagatcagaaacaacacatactgttacatttgatgaagagccaaccttccgttac
tttgaaagagctgacggtgaaaaagatgaccaaacatctcaaacatttagtacaacatct
caaacatcatcgtggatgagagaagctggtgttgatccggttgttcgtagttacattaga
cacaaattaatgggccgaaatgaatatttcttcaagatttggcactatcctaagaaagaa
tctcgatcaaaatga

DBGET integrated database retrieval system