KEGG   Thermoproteus uzoniensis: TUZN_0825Help
Entry
TUZN_0825         CDS       T01460                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00260  Glycine, serine and threonine metabolism
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01120  Microbial metabolism in diverse environments
tuz01230  Biosynthesis of amino acids
Module
tuz_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TUZN_0825
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TUZN_0825
Enzymes [BR:tuz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TUZN_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HypA DFP TF_Zn_Ribbon zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AEA12311
UniProt: F2L562
Position
complement(718369..719373)
Genome map
AA seq 334 aa AA seqDB search
MRVVCARCGYEREGDELRCPKCGGPFTVVVDFPYRERVRENFPYIRRWVTLGEGNTPLVE
VGGVKFKLEFLNPTGSFKDRGSAVLISALAERGVRRISEDSSGNAGASIAAYGALAGMEV
EIYVPETARGGKLKQIEAYGAKVVRVPGGREAVARAAEAANAYYASHVWRPEFRDGIRTL
AYELVRGGKAPEAVYLPTSAGTLLLGVYSGFKHLLDSGVIDEMPRLVAVQTEQVRPLCAA
VKGERYTPPDRLTSMADALVSTNPPLLPEMAEVVRRHGDCVWVAEPEIEAAWRWLARRGL
LAEPSSAVALAGYWKLGAGEDAVVVLTGSGLKTL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagggtggtctgcgcccggtgcggctacgagagggagggcgacgagctccggtgcccc
aagtgcggagggccctttaccgtggtcgtcgactttccgtatagggagagggtaagggag
aacttcccctacataaggcgttgggtgacgctgggcgagggcaacacgccgcttgtcgag
gtcgggggcgtcaagttcaagctggagttcctcaaccccacgggcagtttcaaggacagg
gggtcggccgtcctcatctcggcgttggcggaaaggggagtgcggaggatctccgaggac
tcgtcgggcaacgccggggcctccatagcggcctacggggcgctcgcgggcatggaggtg
gagatctacgtgccggagaccgcaaggggcggcaagctcaagcaaatagaggcctacggc
gccaaggtcgtaagggtgccgggcggcagagaggccgtggcgagggccgccgaggcggca
aacgcctactacgcctcgcacgtctggaggccagagttcagagacgggattaggacgttg
gcctacgagctggtaaggggcggcaaggcgcccgaggcggtttacctgcccacgtctgcg
ggcaccctcctcctgggcgtctactctggcttcaaacacctcctcgactccggcgtgata
gacgagatgccgaggcttgtggccgtgcagaccgagcaagtgaggcctctctgcgccgcg
gtaaagggcgagaggtacacgccgcctgaccggctgacgtctatggcagacgcgctggtc
tcgacgaacccgcccctactgcccgagatggccgaggtcgtgcggagacacggcgactgc
gtctgggtcgccgagccggagatagaggctgcctggcgctggctggcgaggcgcgggcta
ttggccgagccgtcgtcggccgtggcgctggcgggctattggaagctgggcgccggggag
gacgccgtggtggtcctcacagggagcggcttgaagacgctatga

DBGET integrated database retrieval system