KEGG   Thermoproteus uzoniensis: TUZN_0994Help
Entry
TUZN_0994         CDS       T01460                                 

Definition
(GenBank) 2-oxoglutarate synthase, 2-oxoacid-ferredoxin oxidoreductase CD subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00010  Glycolysis / Gluconeogenesis
tuz00020  Citrate cycle (TCA cycle)
tuz00620  Pyruvate metabolism
tuz00633  Nitrotoluene degradation
tuz00640  Propanoate metabolism
tuz00650  Butanoate metabolism
tuz00680  Methane metabolism
tuz00720  Carbon fixation pathways in prokaryotes
tuz01100  Metabolic pathways
tuz01120  Microbial metabolism in diverse environments
tuz01130  Biosynthesis of antibiotics
tuz01200  Carbon metabolism
Module
tuz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
tuz_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_0994
   00020 Citrate cycle (TCA cycle)
    TUZN_0994
   00620 Pyruvate metabolism
    TUZN_0994
   00640 Propanoate metabolism
    TUZN_0994
   00650 Butanoate metabolism
    TUZN_0994
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_0994
   00680 Methane metabolism
    TUZN_0994
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TUZN_0994
Enzymes [BR:tuz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TUZN_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer4_8 Fer4_2 Fer4_17 Fer4_15 Fer4_13 Fer4_4 Fer4_3 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AEA12476
UniProt: F2L680
Position
complement(870138..871082)
Genome map
AA seq 314 aa AA seqDB search
MYLMRIESVWIGRGGQGIVTAVYIVAHASISDGLYALANPEFGAERRGAPVKAFLTLTDY
FDDSPEPIKNPDVAVFLDDKLIEPMRVVVDAVRPGGYVAVSSGKSPEDVAKLVGRRDVNI
AVVDGIGIALKHVGLAVPNGPMVGVFARVMGIPRLESVKEAIASQLGKAVEQNFAAAVEA
YKTAVVIPASETGSARASVEIPTTSAFLTGDYELVGWDKIPEGGLAFPGSSLRYKTGSWR
VERPVIDHSKCIMCRRCWIYCPDDAVLEVWREAKGPRGRSVKVKSIDFDYNYCKGCGICA
EVCPTGAIKMVREI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaatgaggatagagtcggtctggatcggcagaggcgggcagggcatagtcacc
gccgtatacatagtcgcgcacgcctcaatctccgacggcctctacgccttggccaatccc
gagttcggcgccgagcgcagaggcgccccagtgaaggcctttctgaccctcacggattat
ttcgacgactcgcccgagcccataaagaacccggacgtggcggttttcctggacgacaag
ctgatcgagcccatgagggtggtcgtggacgcggtgaggccggggggatacgtggcggtg
agctcggggaagagcccggaggacgtggccaagctggtggggcggcgcgacgtgaacatc
gcggtggtcgacggcataggcatagccctcaaacacgtggggctcgccgtgcccaacggc
cccatggtgggcgtcttcgccagagtgatggggatccccaggctcgagtcggtgaaggag
gccatagcgtcccagctgggcaaggccgtggagcagaacttcgcggcggccgtggaggcc
tacaagacggccgtggtgataccggcctccgagacggggagcgcgagggcctcagtggag
atacccaccacctccgcgtttctcacgggggactacgagctggtgggctgggacaaaata
ccggagggcgggctggcgttcccgggcagcagcttgcggtacaagacgggctcctggcgc
gtggagaggcccgtaatagaccactccaagtgcataatgtgcaggaggtgctggatatac
tgccccgacgacgcggtgctcgaggtgtggagggaggccaagggcccgcgcggcaggtcg
gtcaaggtcaagtccatagacttcgactacaactactgcaagggctgcggcatatgcgcc
gaggtgtgccccacgggggccataaagatggttagggagatatga

DBGET integrated database retrieval system