KEGG   Trichomonas vaginalis: TVAG_038130Help
Entry
TVAG_038130       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K10891  fanconi anemia group D2 protein
Organism
tva  Trichomonas vaginalis
Brite
KEGG Orthology (KO) [BR:tva00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tva03400]
    TVAG_038130
DNA repair and recombination proteins [BR:tva03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     TVAG_038130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 POC3_POC4 FANCI_S2
Motif
Other DBs
NCBI-GeneID: 4772700
NCBI-ProteinID: XP_001326930
UniProt: A2DXX1
AA seq 1176 aa AA seqDB search
MPPPNTDNDGGNRSKSQKLLSSVGVNIAGNGQLQFSIPPSQIISKIQKFVEKTSEEELQT
IIHMICDELTQPETLKNWLTPPNSSNQSFISILLENKKFQTSIVETLCQYLSLTDTETSM
DVPREITKLILQSLKFHSRIYEPEKVASALFDAINNAKDVLQPLIIGSLHEILDSSSFVV
NDLLDLMTRTPALTKDILGSFEGFELSQEDKNKIREKVMKDTLSAVGPSDLNVVIQFLMD
TTDKSNSQQTVESFRENIVVSNDENNETDDSDVFLILILKNSLRVNTDFASAYIKVMHDQ
MELEAIDMWALYCLFDIANRRNDAITTITKLIHGNSINEDSINRSIKGHGKAVQSIARSL
TDLISYLLENNSGELQETGNFLAMALFGESQHLGIQQDIIASILQQIGIGNDPNKKNAIK
LLQKMSEEYPEKMKFHSHILEALLFSYQSMPLDIFKIGVNIIVKLTFTDQSSIELNAGSQ
LHVFLRKMLNKSSTGEAKFGIIVAASILKRYAEICNEEDSPVQKHFSYIIDMTSGNLPIT
AMLFQELSEDRPDSKSLNTMLYNLLRQSLETLLTPSIDNNLERFGIGDNSKYAVMFYEAA
TTEPTQRTLSLSRVGNANLLTKAAYIFSHGALELFLDCAVSIQKEDLNLLNLPLHLFRIS
GDETITQLKELSILYMAHNWLVTLINHYGHLQNEAIFTRIDNLLDVDDQMLSIYSEDLEF
SKLDEVVPKIPKVESIAKKANSKDERSSFFINELHNYFITPNIDFCSMMLKLEFPLDDQK
FRILIRLLNSYSKLIETPKKKSKETPIEYPFKTKQLSQPSNEIIQWLSTVLLPNLLKSDN
RKAPFVTIQVIELIAMQFTMPCYKNADFYAELLNSISGTRSRKKTFMMFNDFINEEMSSD
VVSSILYLMRTVLHSGPSSRIDKHGEEAEIINKRCKELLKKSDKPLNTKSVKTVLQMLFE
HNPCPIDDVREFAVNVLCVEIYTENKRDEDWPCINEKTAPIFFHECFGVLNKELHDISQK
MSKQGTLRDEATILQVLERLEEIMICTKGLYNSTIAYKLPVSIMRDSLKMGGVWLTECMG
LFDFLKDAYNVDSLKVNEFLTNLKTVRRYVNSKIRFVKVESKDKTLNALVPAVQKPMSMI
TYKMKQLIIDTQGTEGTTLTPMRDKDLTGANLDSQG
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaccaaatacggacaatgatggaggaaacaggtcaaaaagccagaagttactt
tcgagtgttggtgtgaatatagctggtaatggccaattacaattttccattccaccaagt
caaatcatatcaaaaatccaaaaatttgttgagaaaacaagcgaagaagaactccaaaca
ataatacacatgatatgtgatgaattaactcaaccagaaactctgaaaaactggctgaca
cccccaaatagttcgaatcaatcatttatcagcatcttactcgagaacaagaaatttcag
acgagcattgtcgaaacactctgccagtacttatcgttaacagacacagaaacctccatg
gatgttcctagagaaattacaaaattaatattacaatctctgaagtttcattcacgaatt
tacgagcccgagaaggttgcttctgcgttattcgatgcaatcaacaacgcgaaagacgtt
cttcagcctttaatcatcggatctcttcacgaaatcttggacagctcttcattcgttgta
aacgacttacttgacctaatgacacgtacaccagcccttaccaaagatatccttggctct
ttcgaaggttttgagctttcccaagaagataaaaataaaattcgcgaaaaagtaatgaaa
gacactttgtcagctgttggaccttcagatttaaatgttgttattcaattccttatggat
acaactgataaatccaattcccaacaaacagttgaatcatttcgcgaaaatatcgttgtt
tctaacgatgaaaacaacgaaactgatgactctgatgtattccttatccttattttgaag
aacagtttaagagttaacacagatttcgcttctgcttatattaaagtaatgcatgaccag
atggaactggaagctatcgatatgtgggcattatactgtttgtttgatattgctaataga
aggaatgacgcaattacaacaattacaaaattaattcatggaaattcaataaacgaagat
tccataaataggagtataaaaggtcatggaaaggctgtacagtctattgctagatctctt
actgatctaatttcttatcttttggaaaataattctggtgaattacaagaaacaggaaat
ttcttggccatggcgctttttggagagtcccaacatttgggaatacaacaggacataatt
gcgtcaattctgcagcaaattggaataggaaatgacccaaataagaaaaatgccattaaa
ttactccaaaaaatgagcgaagagtacccagaaaagatgaagttccactcacatatctta
gaagctcttcttttctcttatcagtcgatgcctttggatattttcaaaattggagtcaat
ataatcgtaaaactcacattcaccgaccaatcaagtattgaacttaacgccggatctcaa
ctccacgtgtttttgagaaaaatgttgaataaaagctcaacaggagaggccaaattcggt
attattgtggccgcaagcattcttaagagatatgccgagatttgcaatgaagaagactct
cctgttcagaaacatttcagttatataattgatatgacctctggaaaccttccaattacg
gccatgctgttccaggaattatcagaagacagaccagactcaaagtcattgaacacaatg
ctttataacttactcagacagtcattagaaacattattaactccaagtatagataacaac
ctcgaaaggttcggtataggcgataatagtaaatacgcagtcatgttctacgaagcagcg
acaacagaaccaacacaaagaacgttatctttatccagagtaggaaatgccaatttattg
acaaaagcagcgtatatattttcacatggagctttggagttattcttggactgcgcagtt
tcaatacaaaaggaagatttaaatttattaaacttacctcttcatttgtttagaatttca
ggcgatgaaacaatcacacagcttaaggaactatccatcctttacatggcgcataactgg
cttgtaaccttgataaatcattacggacatctccaaaacgaagccattttcacacgaatc
gacaatctgttggacgtagatgatcagatgctatccatatatagcgaagatttagagttt
tctaagttagatgaagttgttccgaaaattccgaaagttgaatcgattgcgaagaaagca
aactcgaaagatgaaagatcatcattcttcatcaacgaattgcataactacttcatcacc
cctaacatagatttctgttctatgatgttaaaacttgaatttcccttggacgatcaaaaa
ttcagaattttaataaggttattaaattcttattcgaaattgatcgaaactccaaagaaa
aaatcaaaggaaacacctatagaataccccttcaaaacaaaacaattgtcacaaccgtca
aatgaaataattcaatggttgtcgacggttttgttgccaaatttactaaaaagtgacaac
agaaaagccccatttgttaccatacaagtcattgagcttattgctatgcagtttacgatg
ccatgttacaagaatgccgatttctatgcggaattattgaattccatttcaggaacgaga
tctcgcaagaaaacatttatgatgtttaatgatttcatcaatgaagaaatgtcttctgat
gttgtttcgagtattttgtatctgatgaggactgttctacattctggaccttcttcaaga
atagataaacacggtgaagaagcagaaataatcaataaaagatgtaaagaactcctcaaa
aaatctgacaaaccgttaaatacaaaaagtgtcaaaacggttttacaaatgttatttgaa
cataatccatgtccaattgatgatgtcagagagtttgctgttaatgtattatgtgtagaa
atatacacagaaaacaaaagagatgaagattggccatgtattaatgaaaaaactgctcca
atatttttccatgaatgttttggagttttgaacaaagaattacatgatatttcccagaaa
atgtcaaaacaaggaacattgagagatgaagcaacaatcctacaagtgttagaaagattg
gaagagataatgatctgtacaaaaggtttgtataactcaacaatcgcttataaacttcct
gtttcaataatgagagattctctaaaaatgggaggtgtttggctcactgaatgcatgggt
ttgttcgacttcttgaaggacgcatataacgtggactctttgaaagtaaatgagttcttg
acaaacttgaaaacagtcagaagatacgtcaactctaaaattagattcgtcaaagtcgaa
tcaaaagataaaacattgaatgctttagttcctgcagtccaaaaaccaatgtcaatgatc
acgtataagatgaaacagttgataattgatactcagggaactgaaggaactactttgact
cctatgagagacaaggatttaactggagcaaacttggattcacaaggataa

DBGET integrated database retrieval system