KEGG   Trichomonas vaginalis: TVAG_047830Help
Entry
TVAG_047830       CDS       T01022                                 

Definition
(RefSeq) peptidylprolyl isomerase
  KO
K09567  peptidyl-prolyl isomerase H (cyclophilin H) [EC:5.2.1.8]
Organism
tva  Trichomonas vaginalis
Pathway
tva03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    TVAG_047830
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tva03041]
    TVAG_047830
   03110 Chaperones and folding catalysts [BR:tva03110]
    TVAG_047830
Enzymes [BR:tva01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     TVAG_047830
Spliceosome [BR:tva03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    TVAG_047830
Chaperones and folding catalysts [BR:tva03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    TVAG_047830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 4755977
NCBI-ProteinID: XP_001311112
UniProt: A2FAA8
AA seq 178 aa AA seqDB search
MIEKEPDWVGPRVFFDVSIAGNLIGRVKIELRPDICPLACENFRRFCTGEYRPKGVPLGY
KGTRFHRVVPGFIVQGGDCDTQDGYGCISIYGREFNDEPSAYKFDETGIVAMANSGPNSN
GCQFFITMNPAPELNDSYVVIGKVFEGMLVLRHIESVPLKPHSEIPTLDCIISQCGEL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaaaagagcccgattgggttggtcctcgggtatttttcgatgtatcaatagct
ggtaatttaataggtagagtaaagatagaattgcgtcctgatatatgtccattagcttgc
gaaaattttagaagattttgtactggcgaatacaggccaaaaggagtgccattaggatac
aaagggacaagatttcatcgtgttgttcctggttttattgttcaaggtggagattgtgat
acacaagatggatatggatgtatctcaatctatggccgcgaatttaatgatgagccatca
gcttataaatttgatgaaacaggaatcgtagcaatggcaaatagtggcccaaattcaaat
ggttgccaatttttcattacaatgaatccagctccagaactaaatgatagttatgttgtc
attggcaaagtttttgaaggaatgcttgttctgagacatattgaaagtgttcctttgaaa
ccacacagtgaaattcctacacttgactgtataatatctcagtgtggtgagttataa

DBGET integrated database retrieval system