KEGG   Trichomonas vaginalis: TVAG_097340Help
Entry
TVAG_097340       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
tva  Trichomonas vaginalis
Pathway
tva03030  DNA replication
tva03420  Nucleotide excision repair
tva03430  Mismatch repair
tva03440  Homologous recombination
Module
tva_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TVAG_097340
   03420 Nucleotide excision repair
    TVAG_097340
   03430 Mismatch repair
    TVAG_097340
   03440 Homologous recombination
    TVAG_097340
DNA replication proteins [BR:tva03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    TVAG_097340
DNA repair and recombination proteins [BR:tva03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     TVAG_097340
   MMR (mismatch exicision repair)
     TVAG_097340
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     TVAG_097340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C RMI2 tRNA_anti-codon BOF
Motif
Other DBs
NCBI-GeneID: 4740094
NCBI-ProteinID: XP_001295395
UniProt: A2GK52
AA seq 241 aa AA seqDB search
MFNIKFRTFFYPLSYDPITEQLVFFSFRISVRTQLFYNHTFLQIYLNILFKVKSRKQVSI
VGKIISHEDSTISIDYLVNDCTGSIKVKNFISDDNPEPIPDGTYVFVVGRITPAIEDGIS
SFTIKPITEFDQIPYHMLYSLFVHLQTTRGTPPDSSFAQAPKHIETAPPPMRSSEDRDEK
IKNDVIEFLKENNSDRGTPEEQIIQHFSHIYSAEEVKKAVETANFNGEIYSTSEDNCYNP
C
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacattaaatttagaacattcttttatcctctttcatatgatccaataacagaa
caattagtttttttttcattcagaatctccgtaagaacacaacttttttataatcataca
tttctgcagatatacttaaacatcttgttcaaggttaaatcaagaaaacaagtatccatc
gtaggaaagattattagccatgaagatagcacaatcagcattgattacttggtgaatgat
tgtacaggcagtatcaaagttaagaatttcatttcagatgataatccagagccaattcca
gatggaacatacgtttttgttgttggaagaattacacctgctattgaagatggaatatct
tcattcacaatcaaacccataacagaattcgatcaaattccttatcatatgctttactca
ttgttcgtacacttacagacaacaagaggaacacccccagactcctctttcgctcaagca
ccaaagcatattgaaacagcacctcctccaatgcgatcaagcgaagacagagatgaaaag
attaagaacgatgtcattgaattcctcaaagagaacaattcagatcgcggaactccagaa
gaacaaattattcaacatttctcacacatatactctgcagaagaagttaagaaagcagtt
gaaacagcaaactttaatggtgaaatctactctacaagcgaagataattgttataatcct
tgctaa

DBGET integrated database retrieval system