KEGG   Trichomonas vaginalis: TVAG_123260Help
Entry
TVAG_123260       CDS       T01022                                 

Definition
(RefSeq) Aldose 1-epimerase family protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
tva  Trichomonas vaginalis
Pathway
tva00010  Glycolysis / Gluconeogenesis
tva00052  Galactose metabolism
tva01100  Metabolic pathways
tva01110  Biosynthesis of secondary metabolites
tva01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVAG_123260
   00052 Galactose metabolism
    TVAG_123260
Enzymes [BR:tva01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     TVAG_123260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 4753497
NCBI-ProteinID: XP_001308665
UniProt: A2FH97
AA seq 355 aa AA seqDB search
MSAKTSSSLNIADYETTHQGKQVKLIVLKNSKGMEVCVSNFGANIVSFVVPDKDGKLRDI
VLNQPTIKDIIENSFRFTGATCGRSTNRIAKGHFIIDGNEYTCPINNDINNNHTGVSGFH
NNVWDIVEQTANKAVIRYVSVDGADGFPGNLETTLTFTVDEENALRLDFDYKTDKPTVCS
ITQHSFFNLTQPEDDVFDTDLQVFADFFTPVDDHMTPTGEVLKVAGTVFDFREPMALGKH
ILDNDDQIIKGTGYDHTFVLRKQWRNQLALAAKAFNKKSGITLEMHTDMPGMQLYTANWM
DGFAGKYGTKCDKRHAFCLEAGAIPNSINTNWFPSTTVYPGQPGHNVIVFKAGLL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaagacatcctctagccttaatattgcagactacgagacaacacaccagggc
aagcaagtcaagcttatagtccttaagaactctaagggaatggaagtttgcgtttccaac
tttggcgcaaacattgtttcctttgttgtaccagataaagatggcaagcttcgtgatatc
gtccttaaccagccaacaatcaaggatatcattgagaattccttcagatttactggtgct
acatgtggcagatcaacaaacagaattgccaagggccatttcatcatcgacggcaatgag
tacacatgcccaatcaacaacgacatcaacaataaccacactggtgtctctggtttccac
aacaatgtttgggacattgtcgaacaaacagctaacaaggccgttatcagatatgtttct
gttgatggtgctgatggcttcccaggcaaccttgaaacaacactcacattcactgttgat
gaggagaatgctcttagattagacttcgactacaagacagacaagccaacagtttgctca
atcacacagcactcattcttcaacctcacacagccagaagatgatgtcttcgacacagat
cttcaggtctttgctgatttcttcacaccagttgatgatcacatgacaccaacaggcgaa
gtcctcaaggttgctggcacagtcttcgacttcagagaaccaatggccctcggcaagcac
attcttgataatgatgaccagatcattaagggaacaggctacgaccacacattcgtcctc
cgcaagcagtggagaaaccagctcgctcttgctgccaaggctttcaacaagaagtccggt
attacactcgaaatgcacacagatatgccaggcatgcaactctacacagctaactggatg
gatggatttgctggcaaatacggcacaaagtgcgacaagagacacgctttctgcctcgag
gccggtgctattccaaactccatcaacactaactggttcccatcaaccacagtctatcca
ggacagccaggacacaacgtcattgttttcaaggctggccttctctaa

DBGET integrated database retrieval system