KEGG   Trichomonas vaginalis: TVAG_126050Help
Entry
TVAG_126050       CDS       T01022                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
tva  Trichomonas vaginalis
Pathway
tva00220  Arginine biosynthesis
tva00330  Arginine and proline metabolism
tva01100  Metabolic pathways
tva01110  Biosynthesis of secondary metabolites
tva01130  Biosynthesis of antibiotics
tva01230  Biosynthesis of amino acids
Module
tva_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    TVAG_126050
   00330 Arginine and proline metabolism
    TVAG_126050
Enzymes [BR:tva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TVAG_126050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 4767403
NCBI-ProteinID: XP_001321667
UniProt: A2ECZ3
AA seq 144 aa AA seqDB search
MALAQTLGLGDKEITAMLPKTVPANNALFVGLRYFGEPAEQCRKDLKIPYISCEVANKSS
QEILDWIKQTGKSKILIHFDLDVLEPTQLKIAVGFDPDGLRIEAVTRIISDVAKNYDLVG
LTVAEPMPREVIKLRALLHSLPIF
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggctttggctcaaacattaggtcttggcgataaagaaatcacagcaatgttaccaaag
acagtccctgcaaacaatgctctctttgttggtttgagatatttcggagaaccagctgaa
cagtgccgcaaagatctcaagattccttacatttcatgtgaagttgcgaacaaaagctca
caggagatcttagactggatcaaacagacaggaaagtctaaaatccttattcacttcgac
ttagatgttttagaaccaactcaacttaaaattgcagttggttttgatccagatggtctc
cgtattgaagctgttactcgtattatcagtgatgttgctaagaactatgatcttgtcggc
cttactgttgctgaaccaatgccacgtgaggttatcaaactccgtgcattacttcatagc
cttccaatcttctaa

DBGET integrated database retrieval system