KEGG   Trichomonas vaginalis: TVAG_134820Help
Entry
TVAG_134820       CDS       T01022                                 

Definition
(RefSeq) Glutaminase family protein
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
tva  Trichomonas vaginalis
Pathway
tva00220  Arginine biosynthesis
tva00250  Alanine, aspartate and glutamate metabolism
tva00471  D-Glutamine and D-glutamate metabolism
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TVAG_134820
   00220 Arginine biosynthesis
    TVAG_134820
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TVAG_134820
Enzymes [BR:tva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     TVAG_134820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 4740056
NCBI-ProteinID: XP_001295356
UniProt: A2GK90
AA seq 244 aa AA seqDB search
MQSISKVISLIMALKDNTIQDVFEKVGTEPTKYKFNSLIPIDDKPSNPLINAGAITTASL
IVGKDVDEKFQRVLNMVKKLSNSDKISFLKEVYTSEMETTDVNKSIAYYLRSKKIFSLNA
DEVLDLYIRNCSIGINATELANGGSVLANGGSDLVTGDEMVSKEAVKIVLAQMASCGMYE
ESGEFLLNVGIPSKSGVSGAILGIVPGKCGICTYSPRLDESGNSIRGKNLLKILSNDLNL
NIFL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctatttcaaaggttatatcacttataatggctttaaaagataacactatacaa
gatgtatttgaaaaagttggaactgaaccaactaaatacaagtttaattctctaatacca
atagatgacaagccatctaatccattaataaacgctggtgccattacaacagcatcgtta
atagtgggtaaggacgtggacgaaaaattccaaagagttcttaatatggtaaaaaaatta
tcaaatagcgacaagataagcttcctaaaagaggtctatacttctgaaatggaaactact
gatgtcaataagtcaattgcctactacctaaggagcaagaaaattttctcattaaatgct
gatgaagtattggacttatatataagaaattgttccataggaattaatgcaactgaatta
gctaatggtggttcggttctagctaatggtggttctgatcttgtgacaggcgatgaaatg
gtttcaaaagaagcagttaaaattgtccttgcacaaatggcatcctgcggtatgtatgaa
gagagtggcgaatttcttctaaacgtgggaattccatcaaagagtggcgtcagcggagct
atacttggtattgtacctggtaaatgtggaatttgcacttattctccaagacttgatgag
tcaggaaactcaatccgtggcaagaaccttttgaaaatcttgtcaaacgatctaaattta
aacatatttttataa

DBGET integrated database retrieval system