KEGG   Trichomonas vaginalis: TVAG_151220Help
Entry
TVAG_151220       CDS       T01022                                 

Definition
(RefSeq) cytoplasmic heat shock protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tva  Trichomonas vaginalis
Pathway
tva03040  Spliceosome
tva04141  Protein processing in endoplasmic reticulum
tva04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    TVAG_151220
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TVAG_151220
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    TVAG_151220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tva01009]
    TVAG_151220
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tva03041]
    TVAG_151220
   03009 Ribosome biogenesis [BR:tva03009]
    TVAG_151220
   03110 Chaperones and folding catalysts [BR:tva03110]
    TVAG_151220
   04131 Membrane trafficking [BR:tva04131]
    TVAG_151220
   03051 Proteasome [BR:tva03051]
    TVAG_151220
   03029 Mitochondrial biogenesis [BR:tva03029]
    TVAG_151220
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_151220
Protein phosphatases and associated proteins [BR:tva01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     TVAG_151220
Spliceosome [BR:tva03041]
 Complex B
  Other components
   Prp19 complex
    TVAG_151220
 Complex C
   Prp19-CDC5 complex
    TVAG_151220
Ribosome biogenesis [BR:tva03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    TVAG_151220
Chaperones and folding catalysts [BR:tva03110]
 Heat shock proteins
  HSP70 / DNAK
   TVAG_151220
Membrane trafficking [BR:tva04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    TVAG_151220
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    TVAG_151220
Proteasome [BR:tva03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    TVAG_151220
Mitochondrial biogenesis [BR:tva03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    TVAG_151220
Exosome [BR:tva04147]
 Exosomal proteins
  Proteins found in most exosomes
   TVAG_151220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 4763000
NCBI-ProteinID: XP_001317358
UniProt: A2EQB9
AA seq 659 aa AA seqDB search
MSAIGIDLGTTYSCVGVFRHNRVDILANDMGNRTTPSYVAFTEDERLVGDAAKNQAAMNP
QNTVFDAKRMIGRKFSDPVVQKDMKHWPFKVVRSDGDRPKIEVQFKGETKQFFPEEISAM
VLGKMKETAENMLSEKITDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIA
FGLNEKSDKERHVLIFDLGGGTFDVSLLDIDGGMFEVRATAGDTHLGGEDFDSRLVDYFA
DRFQKKFKCDLRESPRALRTLRTACERAKRTISTAANASILCESLYQGHDFQDTISRAMF
ENLNDELFRSTLGPVAQVLKDAKMSKSDVTDIILVGGSSRIPRVQQLLQEFFNGKQPCRG
VDPDEAVAYGAAVQAAIIKGDNSEAVKDILLLDVAPLSLGIETAGEIMTVLIPRNTTIPA
KKSNIFTTFADNQPAVTIKVYEGERTRTRDNNLLGTFDLTGIPPAPRGVPQIEVTFDVNA
DGIMNVSAQDKSTGNVKKITIKNDKGRLSQADIDRMVSDAEKYKAQDEEIKKKTEAKNGL
EGYCFGVRNSVNGELGSKIDAADKDAILKVVNDTLAWIESNQDASVSDYENKQKDVEGQL
MPLMQKAYQSAAGGAGGMPGGVDPSMFQNMGGAGGAAPGAGPSAGARPSGSGPRVEEVD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctattggtattgatcttggtacaacatactcctgcgttggtgttttccgccac
aaccgtgtcgacatcctcgccaacgatatgggtaacagaacaacaccttcttatgtcgca
ttcacagaagacgagagactcgtcggtgatgctgctaagaaccaagctgctatgaaccca
cagaacacagtcttcgatgctaagcgtatgattggccgtaagttctctgatccagtcgtc
caaaaggatatgaagcactggccattcaaggtcgtccgcagtgatggcgaccgtccaaag
attgaagtccaattcaagggcgagacaaagcaattcttcccagaagaaatctcagccatg
gtcctcggcaagatgaaggaaacagctgagaacatgctctcagaaaagattacagatgct
gtcgttacagttccagcttacttcaacgatggccaacgtcaggctacaaaggatgctggt
gttatcgctggccttaacgtcctccgtatcatcaacgagccaacagccgctgctattgct
ttcggtctcaacgagaagtccgataaggaacgccacgttctcatcttcgatctcggtggt
ggcacattcgatgtttcccttcttgatatcgatggtggcatgttcgaagttcgtgctaca
gctggtgatacacaccttggtggtgaagacttcgattcacgccttgtcgattacttcgct
gatcgtttccagaagaagttcaagtgcgatctgcgcgaatcaccacgtgctttgagaaca
ctcagaacagcttgcgagcgtgctaagcgtacaatctctacagctgctaacgcatccatc
ctttgcgagtctctctaccagggccacgatttccaggatacaatttctcgtgctatgttc
gagaacttgaacgatgaactcttcagatccacacttggcccagttgcacaggttctcaag
gatgcaaagatgtcaaagtccgatgtcacagatatcattcttgtcggtggttcatcacgt
attccacgtgtccagcagctcctccaggagttcttcaacggcaagcagccatgccgtggt
gtcgacccagatgaggccgtcgcttacggtgctgcagtccaggccgccatcatcaaaggc
gataactccgaggcagtcaaggatatcttacttctcgatgtcgctccactttctcttggt
attgaaacagctggcgaaatcatgacagttttgattccacgtaacacaacaattccagcc
aagaagtcaaacatcttcacaacattcgctgataaccagccagcagttacaatcaaggtc
tacgaaggtgagcgtacaagaacacgcgacaacaaccttcttggtacattcgatctcaca
ggcattccaccagcaccacgtggtgttccacagatcgaagttacattcgatgtcaacgct
gatggtatcatgaacgtttctgctcaggataagtccacaggtaatgtcaagaagatcaca
atcaagaacgacaagggccgtctttcccaggcagatatcgaccgcatggtttctgatgct
gagaagtacaaggctcaggatgaagagatcaagaagaagacagaggcaaagaacggtctc
gaaggttactgcttcggtgttcgtaactctgtcaacggcgaactcggctctaagatcgat
gctgccgacaaagatgccatcctcaaggttgtcaacgacacactcgcttggatcgaatcc
aaccaggacgcttctgtctctgactacgagaacaagcagaaggatgtcgaaggccagttg
atgccactcatgcagaaggcctaccagtctgctgctggtggtgccggcggaatgccaggt
ggcgttgacccatctatgttccagaacatgggtggcgctggtggtgctgctccaggtgct
ggcccatctgctggtgctcgcccatcaggctctggcccacgtgttgaggaagttgattaa

DBGET integrated database retrieval system