KEGG   Trichomonas vaginalis: TVAG_226780Help
Entry
TVAG_226780       CDS       T01022                                 

Definition
(RefSeq) Histone H2B
  KO
K11252  histone H2B
Organism
tva  Trichomonas vaginalis
Brite
Chromosome and associated proteins [BR:tva03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    TVAG_226780
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TVAG_226780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF RP-C AD
Motif
Other DBs
NCBI-GeneID: 4755219
NCBI-ProteinID: XP_001310364
UniProt: A2DJ26
AA seq 129 aa AA seqDB search
MSSKKPASKTPTEKKPAVEGVDAANAAKQDKKLRHKKRAETFSSYIFKVLKQVHPDIGIS
NKAMMVMNSFVTDIFERIAQEGARLVDMNERNTLGSREVQTAVRLVLPGDLAKHAVSEGG
KAVAKFNAE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaagaagccagcatctaaaacaccaacagagaagaagccagccgtcgagggt
gtcgatgccgccaatgctgctaagcaagataagaagctccgccacaagaagcgtgctgaa
accttctcttcctacatcttcaaggttctcaagcaggttcacccagatatcggtatctct
aacaaggctatgatggttatgaactccttcgttacagatatcttcgagcgtatcgctcag
gaaggcgctcgtcttgtcgatatgaacgaacgtaacacactcggttcccgcgaagttcag
acagctgttcgtcttgttcttccaggcgatcttgccaagcacgccgtctcagaaggtggc
aaggctgtcgccaagttcaatgctgagtaa

DBGET integrated database retrieval system