KEGG   Trichomonas vaginalis: TVAG_246600Help
Entry
TVAG_246600       CDS       T01022                                 

Definition
(RefSeq) 60S ribosomal protein L39
  KO
K02924  large subunit ribosomal protein L39e
Organism
tva  Trichomonas vaginalis
Pathway
tva03010  Ribosome
Module
tva_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TVAG_246600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tva03011]
    TVAG_246600
Ribosome [BR:tva03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    TVAG_246600
  Archaea
    TVAG_246600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L39
Motif
Other DBs
NCBI-GeneID: 5464499
NCBI-ProteinID: XP_001579968
UniProt: A2D9N4
AA seq 51 aa AA seqDB search
MAAHKTLRTKRILCKAMKVNRPMPQFIRQMTGVRHIRNPLTRHWRRRKMNI
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcataagacccttagaacaaagcgcattctttgcaaggctatgaaggttaac
cgcccaatgccacaattcatccgccagatgactggtgttcgccatatccgcaacccactt
acacgccactggcgcagaaggaagatgaacatttaa

DBGET integrated database retrieval system