KEGG   Trichomonas vaginalis: TVAG_266630Help
Entry
TVAG_266630       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tva  Trichomonas vaginalis
Pathway
tva00450  Selenocompound metabolism
tva00970  Aminoacyl-tRNA biosynthesis
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TVAG_266630
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TVAG_266630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tva01007]
    TVAG_266630
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tva03016]
    TVAG_266630
Enzymes [BR:tva01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TVAG_266630
Amino acid related enzymes [BR:tva01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TVAG_266630
Transfer RNA biogenesis [BR:tva03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TVAG_266630
 Prokaryotic type
   Other AARSs
    TVAG_266630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 4775317
NCBI-ProteinID: XP_001329523
UniProt: A2DQL6
AA seq 710 aa AA seqDB search
MEIRLISGYKDSVLFKLLAPKLPKNVTITEINSNDRVSASAEFEFKVWPVLYENGTPFLY
GTRAILTYLFTGSELLQQASLTQNDTLFCLGDDLYTAFCPIFTRTQSILVNDKIIAHSQK
AFDEVIAQIPTHKTKEESIGNYYIDSILAIVKALGFKLDLEVPQVTLQADAIAEEALRFC
FQVLNIPERYALSPAPEKPMCLTTPIYYVNGVPHIGHVFTTTLVETISNWYKLRGIDCIY
STGTDEHGLKVQTTAASKGFLPKEWCDKTSKTFFDAFEQFDLHPDVFIRTTDENHIKVAT
KLWTILHEKGYIYEGKYEGWYSKREECFVPENQIKVVVENGVEKHINSEDGAELEWSSET
NWMFKLSAMQQQLLDWYDANPTCITPRPYYNLIKLMVSRGLNDLSVSRQNVTWGIPVPND
PKQTMYVWIDALANYLTVAGWDGEGNFGRWPCDIHTVGKDIVKFHAIYWPAFLIAAGIPC
YKRLLVHGWWTKNEEKMSKSLGNTLDPIVLMKFWGLEAVKYYLLRECTLVSDSDYSDKAM
LNRYNNDLADVLWNLVIRIISKKLCPDMVVPTPGEYQEVDKDLIESIVTIPGTVDHFMAF
GETRHALDSIFASIHDLNKYLTDMQPWKLVKETDLSRYNTVFYTLLECLRILATSLYCFM
PQTATTILNGLGVGKNFPPEEIFKYGFLKPGTKLMEGMPILFPKKTLPDV
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggagattcgcttaatttccggctacaaggactccgtcctcttcaagcttcttgctcca
aagcttccaaagaacgtcacaatcacagagatcaactcgaacgatcgtgtttctgcctct
gctgaattcgagttcaaggtttggccagttctctacgaaaatggcacaccattcctctat
ggtacacgtgctatccttacatacctcttcacaggctctgaactcctccagcaagcctca
ttaacacagaatgatacactcttctgccttggtgacgacctttacacagctttctgccca
atcttcacacgcacacagtccatccttgtcaacgataagatcatcgcccactcacagaag
gctttcgatgaagtcattgcccagatcccaacacacaagacaaaggaagagtcaatcggt
aattactacatcgattccatccttgccatcgtcaaggctctcggcttcaagctcgacctc
gaagttccacaagttacacttcaggccgatgccattgctgaagaggctcttcgcttctgc
ttccaggttctcaacatcccagagcgctatgccctttctccagccccagaaaagccaatg
tgccttacaacaccaatttactacgtcaatggtgtcccacacattggccacgtcttcaca
acaacacttgtcgagaccatcagcaactggtacaagcttcgtggcatcgactgcatctac
tcaacaggtacagatgagcacggcctcaaggtccagacaacagccgcctccaagggcttc
ttaccaaaggagtggtgcgacaagacatccaagaccttcttcgatgccttcgagcagttc
gatctccatccagatgtcttcatcagaacaacagatgagaaccatatcaaggttgccacc
aagttatggacaatcctccacgagaagggctatatctacgaaggcaagtacgaaggctgg
tattccaagcgcgaagaatgcttcgtcccagaaaaccagatcaaggttgttgtcgaaaac
ggcgttgagaagcatatcaactccgaagatggcgccgagctcgaatggtcatctgaaaca
aactggatgttcaaactttccgcaatgcaacagcaattacttgactggtacgatgccaac
ccaacatgcattacaccacgcccatactacaaccttatcaagttaatggtctctcgtggc
cttaatgatctttccgtttctcgccagaacgttacatggggcattccagttccaaacgat
ccaaagcagaccatgtacgtctggatcgacgctcttgccaactaccttacagtcgccgga
tgggatggcgaaggcaatttcggcagatggccatgcgacatccatacagtcggtaaggac
attgtcaagttccacgccatctactggccagccttccttatcgctgctggcattccatgc
tacaagagattgcttgttcacggctggtggacaaagaacgaagagaagatgtcaaagtcc
ctcggaaacacactcgacccaattgtcctcatgaagttctggggcctcgaagctgtcaag
tactacttactccgtgagtgcacattagtttcagacagcgactactcagacaaggccatg
ttgaacagatacaacaacgatctcgctgatgttctctggaacttggttatcagaatcatt
tccaagaagctctgcccagacatggttgttccaacaccaggagagtaccaggaagtcgat
aaggacctcatcgagtcaatcgtcacaatcccaggtacagttgaccacttcatggctttc
ggtgaaacacgccacgctcttgattcaatattcgcttcaatccacgacttgaacaagtac
ctcacagacatgcagccatggaagctcgtcaaggaaacagacttgtccagatacaacact
gtcttctacacactccttgaatgcttgcgtatcctcgctacatctctctactgcttcatg
ccacagacagctacaacaatcctcaacggcctcggcgtaggaaagaacttcccaccagag
gagatcttcaagtacggattcctcaagccaggaacaaagctcatggaaggaatgccaatc
ctcttcccgaagaagacactcccagatgtctaa

DBGET integrated database retrieval system