KEGG   Trichomonas vaginalis: TVAG_299100Help
Entry
TVAG_299100       CDS       T01022                                 

Definition
(RefSeq) helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
tva  Trichomonas vaginalis
Pathway
tva03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    TVAG_299100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tva03041]
    TVAG_299100
Enzymes [BR:tva01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     TVAG_299100
Spliceosome [BR:tva03041]
 Complex C
  Other components
   Step II factors
    TVAG_299100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD S1 AAA_22 Flavi_DEAD AAA_19 AAA_23 AAA_7
Motif
Other DBs
NCBI-GeneID: 4761090
NCBI-ProteinID: XP_001315471
UniProt: A2EVN8
AA seq 1006 aa AA seqDB search
MEKIRELALISAVLEAVKKSMKIDKRQVAEFLISCAKKNNSFDDFIATLKTRKVNLPIDL
SKYIFDVTKRHCNQVIPENTIVPISKASFDEPDIMQPEVGVIYKGRVTSVTNQCAFVKIE
GFHSKPVGMLPVTEMSNDPGSRLLATDIVGVGQHLFVKVIKSMTASLTLSIKGIDQTTGL
SYEEEAVIENTAPTGAFRTMRLSSPERFEVEQLMRAGTVTQNDLHDLAGDYEQISYSSIP
ETYFEIALNKTVPPFLQGLKTDKRKIEPLYVESNPEGSLARSAREASRLSREKQETKRST
QGSSKSIVGLLDDEAPSVIPTIPLSELPEWKRQTFGSFGPTLEKKKLPISDYESQIIDML
SKNRVFILVGETGCGKTTQIPQFLLRSGIAGDLMIGVTQPRRVAAISVAKRVADETNSII
GDLIGYQVRFEEKTSRNTKVKFMTDGMLLKECLGDRQLSNYGVIMLDEAHERTIHTDVLF
GLMKELLSKDDRLKVIVTSATLQKEKFSSFFFNCPVLEVPGRTFPVTTSFAVTAFTDYLQ
ASVNTVLKLHQTEEKPGDILLFLTGQDDIDTACEQIYQRSKPMEENFGKLIVLPIYSSLP
TEQQTMIFQPTPPGQRKVVVATNIAETSITIDGIRYVVDPGLVKEMRYDPRTGMDTLEVV
PISKAAANQRKGRAGRTAAGKCIRLYTEDSYNNEMKETTIPEIQRSNMAMVALDMKVIGI
DDLIGFDFMDKPPTKIIIDALDQLYTLGALDEEGNLTPLGRDMSKFSLNPQLAKMLIMSS
MLGCSEEVLVLVAILSVQGIWYRPRKKQAEADAMKARLNRDEGDHMTLLHVFREWQKNGE
REAWCKENYVHYRSLKRAKDVMTQLRQQMEQFHVPLVSCGKEIIPILKAIVSGFFAKAAR
RYMGTEYKTIVDDHPVYIFPGSALFGREPEYCVFHELVNTTREYMRNTVAVDPRWLVELA
PAFYRKASPLEMTSRKRADRVNPLADRKSDNKDRKWRITEQRIIRI
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaattcgagaattggcattgatttctgctgttctcgaagcagttaagaaatca
atgaagatagataaacgacaagtagcagaatttttgattagttgtgcaaaaaagaacaat
tctttcgatgatttcattgcaactttgaaaactcgtaaagtaaacttgccaattgattta
tcaaaatatatatttgatgttactaaacgccattgcaatcaagttattcctgaaaacaca
atagttccaattagcaaagcatcattcgacgaaccagacataatgcaaccagaggttggt
gttatttacaaagggagagtaacatcagttacaaatcaatgcgctttcgttaaaatcgaa
ggttttcattcaaaaccagtaggaatgttacctgttacagagatgagcaatgatccaggc
agtcgattattagctacagatatcgttggtgttggccaacatctttttgttaaagttata
aaatctatgactgcttcattaacgctatcaatcaaaggaatagatcaaacaacaggccta
agttatgaagaagaggctgttattgaaaatactgctcccacaggcgcatttcggacgatg
agattatcatctccagaaagattcgaagtagagcaacttatgagggccggaacagttacg
caaaacgatttacatgatttagccggtgattacgagcaaatatcttattcctcaatccca
gaaacttatttcgagattgcattaaacaaaaccgttcctcctttcctacaaggcctcaag
acagacaaaaggaaaatcgaacccttgtatgtagaatccaatccagaaggttctctcgca
agatctgctcgagaagcatccagattatcccgagagaagcaagaaacaaagcgatcaaca
caaggatcatcgaagtcaattgttggactactcgatgacgaagcaccatcagttattccg
acaattccattatcagaattaccagaatggaaaagacaaacatttggtagtttcggacca
acccttgagaagaagaaactaccgatatccgattacgaatcccaaataattgacatgctc
tcaaaaaacagagtttttattttggtcggagaaacaggatgtggaaaaacaactcaaatt
ccacaattcctattaagaagtggtatagcaggagatctaatgataggagtaacacaaccg
agaagagttgctgctatttctgttgctaaaagagttgctgatgaaacaaattctataatt
ggagatttaattggttatcaagtcagatttgaagaaaaaacatcaagaaacacaaaagtc
aagtttatgactgatggtatgttattaaaagaatgtcttggagatcgacagctttctaat
tatggtgttattatgttggatgaagctcacgaacgaacaattcacactgatgttttattt
ggcttgatgaaagagttgttgtcaaaagatgacaggttaaaagtaattgttacatccgca
actttacagaaagaaaagtttagttctttcttctttaattgtcctgtcttggaagttcct
ggaagaacatttcctgtaacaacttcgttcgctgtcactgctttcactgattatttgcaa
gcgagtgtaaatacagtattaaaattgcatcaaacagaagaaaaacctggagatattttg
ttgttccttacaggtcaagatgacattgatacggcctgtgaacagatttaccaaagatct
aaaccaatggaagaaaactttggtaaattaattgttcttccaatttattcgagtcttcca
actgaacagcaaacaatgattttccagcctacacctcctggacaaaggaaagttgttgtt
gcaacaaatatcgcggaaacatcaattactattgatggaattcgatatgtcgttgatcca
ggacttgtcaaagaaatgagatatgatccaaggacaggaatggacactttggaagtagtt
ccaatctccaaagcagcagcaaaccaaagaaaaggaagagcaggaagaacggcagcagga
aaatgtataagattatatacagaagatagttataacaatgaaatgaaagaaacaacaatt
cctgaaatacaaagatcgaatatggcaatggttgctttggatatgaaagttattggtatt
gatgatttgattggcttcgatttcatggataagccaccaacgaaaatcatcatcgacgcg
ttggatcaactctatactttaggtgctttggatgaagaaggaaatttgacacctcttgga
agagacatgtcaaaattttcattaaatccacaactcgcgaagatgttgattatgagttct
atgctgggatgttccgaagaagttttggtgcttgttgcaatcttgagtgtacaaggaata
tggtacagaccaagaaagaaacaagcagaagcagatgcgatgaaagcaagattaaacaga
gatgaaggtgatcatatgacattgttacatgtatttagagaatggcaaaagaacggagaa
agagaagcatggtgcaaagagaactacgtacattatagatcattgaaaagagcaaaggat
gtaatgacacagttaagacaacaaatggaacaattccatgttcctttagtttcttgcgga
aaagaaataattccaattttgaaggcaattgtttctggatttttcgcaaaagcagcaaga
agatacatgggaactgagtacaaaacaatagttgatgaccaccctgtttatattttccct
ggatcagcattgttcggaagagaacctgagtactgcgtttttcatgaattagtgaataca
acaagagaatacatgagaaatactgttgctgttgatccaagatggttggttgagttggct
cctgctttctatagaaaggcatctccattggaaatgacgtcgagaaagagagcagataga
gtcaatcctctcgctgatagaaagtcagataataaggatagaaagtggagaatcactgaa
caaagaattattagaatataa

DBGET integrated database retrieval system