KEGG   Trichomonas vaginalis: TVAG_318670Help
Entry
TVAG_318670       CDS       T01022                                 

Definition
(RefSeq) adhesin protein AP33-1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
tva  Trichomonas vaginalis
Pathway
tva00020  Citrate cycle (TCA cycle)
tva00640  Propanoate metabolism
tva01100  Metabolic pathways
tva01110  Biosynthesis of secondary metabolites
tva01130  Biosynthesis of antibiotics
tva01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TVAG_318670
   00640 Propanoate metabolism
    TVAG_318670
Enzymes [BR:tva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     TVAG_318670
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TVAG_318670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig IlvN GFO_IDH_MocA CoA_binding_2 ELFV_dehydrog
Motif
Other DBs
NCBI-GeneID: 4745205
NCBI-ProteinID: XP_001300482
UniProt: O15568
AA seq 309 aa AA seqDB search
MLAGDFSRNLHKPLLFIDKDTKVVIQGIGNQGQFHSRLMRQYGTKVVGAVHPKKAGTIIA
GLPIFKNMKEVVKRTDANASLIFVPAPGAAAACIEAAEAGMGLVVCITEHIPQHDMIKVK
KVMKETGCQLIGPNCPGLIQPGTHTKLGIIPTNIFNNGKIGIVSRSGTLTYEAAYATTLA
GLGQSTVVGIGGDPFAGQLHTDVVKRFAADPQTEGIILIGEIGGTSEEDAAEWIAKTKLT
QEKPVVAFIAGATAPPGKRMGHAGAIVSGGKGTAEGKYKALEAAGVRIARHPGNMGKFIF
EEMKRMGKI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaggcgacttctctcgtaacctccacaagccactccttttcatcgacaaggac
accaaggttgttatccagggtatcggtaaccagggccagttccactcccgccttatgcgc
cagtatggcacaaaggttgttggtgctgtccatccaaagaaggctggcacaatcattgct
ggtctcccaatcttcaagaacatgaaggaggttgttaagagaacagatgctaatgcatct
cttatcttcgttccagctccaggtgctgctgctgcatgcattgaagctgctgaagccggc
atgggtcttgttgtctgcatcacagaacacatcccacagcacgacatgatcaaggtcaag
aaggtcatgaaggaaacaggctgccagcttatcggtccaaactgcccaggtcttatccag
ccaggcacacacacaaagcttggtatcatcccaacaaacatcttcaacaacggtaagatc
ggtattgtttcccgctccggcacactcacatacgaagctgcctacgctacaacactcgct
ggccttggtcagtccacagttgtcggcatcggtggtgatccattcgcaggccaactccac
acagatgttgtcaagcgcttcgctgcagacccacagaccgagggtatcatcctcatcggt
gaaatcggtggcacatccgaagaagatgccgctgagtggatcgctaagacaaagcttacc
caggagaagccagtcgtcgccttcatcgccggcgctacagctccaccaggcaagcgtatg
ggccacgctggtgccatcgtttctggcggcaagggcacagctgagggcaagtacaaggct
cttgaagcagctggtgttcgcattgctcgtcacccaggtaacatgggcaagttcatcttc
gaggagatgaagagaatgggcaagatctaa

DBGET integrated database retrieval system