KEGG   Trichomonas vaginalis: TVAG_382280Help
Entry
TVAG_382280       CDS       T01022                                 

Definition
(RefSeq) haloacid dehalogenase-like hydrolase family protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     TVAG_382280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase PGP_phosphatase
Motif
Other DBs
NCBI-GeneID: 4742693
NCBI-ProteinID: XP_001297981
UniProt: A2GCR2
AA seq 282 aa AA seqDB search
MTQKCVCFDGEGVLWHAGEPIPGASEVINEITKLGYRPIVITNNASKSVEQYYQRFQKSG
YNSFEMSDVITSAAAVGTYLQKIGLDKPNRKIFVIGTAGFVSQLRLQHLQVITTADFDGI
EFHTMELDPSVCAVVVGSSEEFTYRHLAIATRFVIENDAILISANPDNSYPYNPKVLVPG
AHALSVSISVASGRQPKIVGKPDPKVFEAIPGYKDIDIKNSWMIGDRLNTDIAFAKNVGL
KSILVLTGVSKRDECEALSFEEKPDFVCEDLAACLETIKANQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgactcagaagtgtgtctgtttcgatggtgaaggcgttctttggcatgcaggagaacca
atccccggtgcttcagaagtcatcaatgaaattacaaagcttggctatcgtccaattgta
attacaaacaatgcaagcaaatctgtcgagcaatattatcagcgcttccagaaatccggt
tacaattcctttgaaatgtccgatgttattacttctgcagctgcagttggtacctatctt
cagaaaataggtcttgataaaccaaatcgtaaaatatttgttattggtacagcaggtttt
gttagtcagcttagactccaacacctccaagttatcacaacagctgattttgatggcatc
gaattccacacaatggagttagatccatcagtttgcgctgttgttgttggctcatcagaa
gaattcacatacaggcatctcgctattgccactcgtttcgttattgaaaatgatgcaatt
cttatctccgctaatccagataactcctatccatacaatccaaaggttcttgtcccaggt
gctcatgccctttccgtctcaatctcagtcgcttctggccgccaaccaaagattgtcgga
aaaccagatccaaaggtatttgaagccatcccaggatacaaggacatcgatatcaagaac
agctggatgatcggtgaccgcctgaacactgatatcgcttttgcgaagaacgttggcctt
aaatctatcctcgttcttacaggcgtatcaaagcgtgatgaatgcgaagctctttccttc
gaggaaaaaccagattttgtatgtgaagatcttgctgcttgcctcgaaacaatcaaggct
aaccagtaa

DBGET integrated database retrieval system